Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of THP-1 cells, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of various cell lines, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] - Confocal imaging of THP-1 cells using Chitinase 3-like 1/YKL-40 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] - Confocal imaging of paraffin-embedded Rat brain tissue using Chitinase 3-like 1/YKL-40 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clone: 7T1R3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Chitinase 3-like 1/YKL-40 Antibody (7T1R3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 284-383 of human Chitinase 3-like 1 (NP_001267.2). PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CHI3L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

• AW208766
• Brp39
• CHI3L1
• Chitinase 3 like 1
• Chitinase 3-like 1
• gp39
• HCgp39
• YKL-40

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHI3L1