AMCase/CHIA Antibody - BSA Free

Immunohistochemistry: AMCase/CHIA Antibody [NBP2-32440] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry: AMCase/CHIA Antibody [NBP2-32440] - Staining of stomach.

Immunohistochemistry: AMCase/CHIA Antibody [NBP2-32440] - Staining of stomach cancer.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AMCase/CHIA Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHIA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AMCase/CHIA Recombinant Protein Antigen (NBP2-32440PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AMCase/CHIA Antibody - BSA Free

• acidic mammalian chitinase
• AMCase
• CHIA
• CHIT2
• CHIT2DKFZp313J1722
• Chitinase, Acidic
• EC 3.2.1.14
• Lung-Specific Protein TSA1902
• TSA1902AMCase

Background

Degrades chitin and chitotriose. May participate in the defense against nematodes and other pathogens

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHIA