CDS1 Antibody


Immunocytochemistry/ Immunofluorescence: CDS1 Antibody [NBP1-85894] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear membrane.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining in human fallopian tube and endometrium tissues. Corresponding CDS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human duodenum shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CDS1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ
Specificity of human CDS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDS1 Protein (NBP1-85894PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDS1 Antibody

  • CDP-DAG synthase 1
  • CDP-DG synthase 1
  • CDP-DG synthetase 1
  • CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
  • CDP-diacylglycerol synthase 1
  • CDP-diglyceride pyrophosphorylase 1
  • CDP-diglyceride synthase 1
  • CDP-diglyceride synthetase 1
  • CDS 1
  • CDS
  • CTP:phosphatidate cytidylyltransferase 1
  • EC
  • phosphatidate cytidylyltransferase 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB (-), IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDS1 Antibody (NBP1-85894) (0)

There are no publications for CDS1 Antibody (NBP1-85894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDS1 Antibody (NBP1-85894) (0)

There are no reviews for CDS1 Antibody (NBP1-85894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDS1 Antibody (NBP1-85894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDS1 Products

Bioinformatics Tool for CDS1 Antibody (NBP1-85894)

Discover related pathways, diseases and genes to CDS1 Antibody (NBP1-85894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDS1 Antibody (NBP1-85894)

Discover more about diseases related to CDS1 Antibody (NBP1-85894).

Pathways for CDS1 Antibody (NBP1-85894)

View related products by pathway.

PTMs for CDS1 Antibody (NBP1-85894)

Learn more about PTMs related to CDS1 Antibody (NBP1-85894).

Research Areas for CDS1 Antibody (NBP1-85894)

Find related products by research area.

Blogs on CDS1

There are no specific blogs for CDS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDS1 Antibody and receive a gift card or discount.


Gene Symbol CDS1