CDO Antibody

Images

 
Immunohistochemistry: CDON/Cdo Antibody [NBP1-85700] - Staining of human skeletal muscle shows strong positivity in subtypes of myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KSRKSQLSRPEGLNLEPVYFVLSQAGASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDRSKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDON
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
CDO Protein (NBP1-85700PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDO Antibody

  • CDO
  • Cdon homolog (mouse)
  • CDON
  • CDOORCAM
  • cell adhesion molecule-related/down-regulated by oncogenes
  • MGC111524
  • ORCAM
  • surface glycoprotein, Ig superfamily member

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2385
Species: Mu
Applications: WB, IHC
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
NBP1-88529
Species: Hu
Applications: WB, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-88559
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CDO Antibody (NBP1-85700) (0)

There are no publications for CDO Antibody (NBP1-85700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDO Antibody (NBP1-85700) (0)

There are no reviews for CDO Antibody (NBP1-85700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDO Antibody (NBP1-85700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDO Products

Bioinformatics Tool for CDO Antibody (NBP1-85700)

Discover related pathways, diseases and genes to CDO Antibody (NBP1-85700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDO Antibody (NBP1-85700)

Discover more about diseases related to CDO Antibody (NBP1-85700).
 

Pathways for CDO Antibody (NBP1-85700)

View related products by pathway.

PTMs for CDO Antibody (NBP1-85700)

Learn more about PTMs related to CDO Antibody (NBP1-85700).

Blogs on CDO

There are no specific blogs for CDO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDON
Entrez