CDO Antibody

Images

 
Immunohistochemistry-Paraffin: CDO Antibody [NBP1-85700] - CDON/Cdo Antibody [NBP1-85700] - Staining of human skeletal muscle shows strong positivity in subtypes of myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSRKSQLSRPEGLNLEPVYFVLSQAGASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDRSKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDON
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
CDO Protein (NBP1-85700PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDO Antibody

  • CDO
  • Cdon homolog (mouse)
  • CDON
  • CDOORCAM
  • cell adhesion molecule-related/down-regulated by oncogenes
  • MGC111524
  • ORCAM
  • surface glycoprotein, Ig superfamily member

Background

CDON and BOC (MIM 608708) are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII; see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDO Antibody (NBP1-85700) (0)

There are no publications for CDO Antibody (NBP1-85700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDO Antibody (NBP1-85700) (0)

There are no reviews for CDO Antibody (NBP1-85700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDO Antibody (NBP1-85700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDON