ADO Antibody - BSA Free

Analysis in human testis and liver tissues using HPA040437 antibody. Corresponding ADO RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human liver shows low positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human cerebral cortex shows strong positivity in neurons.

Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human smooth muscle shows moderate positivity.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADO Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADO Antibody - BSA Free (NBP1-88530) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADO
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ADO Protein (NBP1-88530PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADO Antibody - BSA Free

• 2-aminoethanethiol (cysteamine) dioxygenase
• 2-aminoethanethiol dioxygenase
• C10orf22
• chromosome 10 open reading frame 22
• cysteamine (2-aminoethanethiol) dioxygenase (ADO)
• Cysteamine dioxygenase
• DKFZp564C046
• EC 1.13.11.19
• FLJ14547

Background

Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase(ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine toform hypotaurine (Dominy et al., 2007 (PubMed 17581819)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADO