HFE Antibody (1G12)

Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.

ELISA: HFE Antibody (1G12) [H00003077-M01] - Detection limit for recombinant GST tagged HFE is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1G12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

HFE Antibody (1G12) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HFE (NP_000401, 115 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
• Specificity: HFE - hemochromatosis
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HFE
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HFE Antibody (1G12)

• dJ221C16.10.1
• hemochromatosis
• hereditary hemochromatosis protein HLA-H
• hereditary hemochromatosis protein
• HFE
• HFE1
• HH
• high Fe
• HLAH
• HLA-H
• HLA-HHFE1
• MGC103790
• MHC class I-like protein HFE
• MVCD7
• TFQTL2

Background

The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HFE Antibody (H00003077-M01)(1)

Publication using H00003077-M01

• Lenarduzzi M, Hui AB, Yue S et al. Hemochromatosis Enhances Tumor Progression via Upregulation of Intracellular Iron in Head and Neck Cancer. PLoS One. 2013-08-26 [PMID: 23991213]

Reviews for HFE Antibody (H00003077-M01) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Mouse.

reviewed by: Ajay Ashok IHC Mouse 06/27/2017

Summary

• Application: Immunohistochemistry
• Sample Tested: Mouse brain
• Species: Mouse

reviewed by: Ajay Ashok WB Mouse 06/21/2017

Summary

• Application: Western Blot
• Sample Tested: Mouse brain
• Species: Mouse

Bioinformatics

• Gene Symbol: HFE
• Entrez:
  • 3077(Human)
• OMIM:
  • 176200(Human)
• Uniprot:
  • NP_000401(Human)