HFE Antibody (1G12)

Images

 
Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.
Immunocytochemistry/ Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected ...read more
ELISA: HFE Antibody (1G12) [H00003077-M01] - Detection limit for recombinant GST tagged HFE is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HFE Antibody (1G12) Summary

Immunogen
HFE (NP_000401 115 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
Specificity
HFE - hemochromatosis
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HFE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Reviewed Applications
Read 2 Reviews rated 4.5
using
H00003077-M01 in the following applications:

Publications
Read Publication using H00003077-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HFE Antibody (1G12)

  • dJ221C16.10.1
  • hemochromatosis
  • hereditary hemochromatosis protein HLA-H
  • hereditary hemochromatosis protein
  • HH
  • high Fe
  • HLAH
  • HLA-HHFE1
  • MGC103790
  • MHC class I-like protein HFE
  • MVCD7

Background

The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB3120
Species: Hu
Applications: WB, Simple Western
AF3720
Species: Hu, Mu
Applications: WB, ICC
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1705-HH/CF
Species: Hu, Mu
AF482
Species: Mu
Applications: WB, IHC
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HFE Antibody (H00003077-M01)(1)

Reviews for HFE Antibody (H00003077-M01) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.
We have 2 reviews tested in 2 application: IHC, WB.

Reviews using H00003077-M01:
Filter by Applications
IHC
(1)
WB
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry HFE H00003077-M01
Enlarge
reviewed by:
Anonymous
IHC Mouse 06/27/2017
View

Summary

ApplicationImmunohistochemistry
Sample Tested Mouse brain
SpeciesMouse
Western Blot HFE H00003077-M01
Enlarge
reviewed by:
Anonymous
WB Mouse 06/21/2017
View

Summary

ApplicationWestern Blot
Sample Tested Mouse brain
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HFE Antibody (H00003077-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HFE Products

Bioinformatics Tool for HFE Antibody (H00003077-M01)

Discover related pathways, diseases and genes to HFE Antibody (H00003077-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HFE Antibody (H00003077-M01)

Discover more about diseases related to HFE Antibody (H00003077-M01).
 

Pathways for HFE Antibody (H00003077-M01)

View related products by pathway.

PTMs for HFE Antibody (H00003077-M01)

Learn more about PTMs related to HFE Antibody (H00003077-M01).

Blogs on HFE.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
06/27/2017
Application: IHC
Species: Mouse

Anonymous
06/21/2017
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol HFE
Entrez
OMIM
Uniprot