BNIP2 Antibody

Images

 
Western Blot: BNIP2 Antibody [NBP1-88559] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: BNIP2 Antibody [NBP1-88559] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: BNIP2 Antibody [NBP1-88559] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-64

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BNIP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BNIP2 Protein (NBP1-88559PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BNIP2 Antibody

  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
  • BCL2/adenovirus E1B 19kDa interacting protein 2
  • BCL2/adenovirus E1B 19kD-interacting protein 2
  • BNIP-2
  • NIP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89335
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-79502
Species: Hu
Applications: WB
AF2429
Species: Mu
Applications: WB, IHC
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46580
Species: Hu
Applications: WB, IHC
NBP2-57680
Species: Hu
Applications: ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-33988
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BNIP2 Antibody (NBP1-88559) (0)

There are no publications for BNIP2 Antibody (NBP1-88559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNIP2 Antibody (NBP1-88559) (0)

There are no reviews for BNIP2 Antibody (NBP1-88559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BNIP2 Antibody (NBP1-88559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BNIP2 Products

Bioinformatics Tool for BNIP2 Antibody (NBP1-88559)

Discover related pathways, diseases and genes to BNIP2 Antibody (NBP1-88559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIP2 Antibody (NBP1-88559)

Discover more about diseases related to BNIP2 Antibody (NBP1-88559).
 

Pathways for BNIP2 Antibody (NBP1-88559)

View related products by pathway.

PTMs for BNIP2 Antibody (NBP1-88559)

Learn more about PTMs related to BNIP2 Antibody (NBP1-88559).
 

Research Areas for BNIP2 Antibody (NBP1-88559)

Find related products by research area.

Blogs on BNIP2

There are no specific blogs for BNIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BNIP2