CD40 Ligand/TNFSF5 Antibody


Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186] - Sample Type: Human Fetal Muscle Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide more
Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP1-59186] - Human thymus tissue at an antibody concentration of 5ug/ml.
Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CD40 Ligand/TNFSF5 Antibody Summary

Synthetic peptides corresponding to CD40LG(CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome)) The peptide sequence was selected from the middle region of CD40LG. Peptide sequence ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CD40LG and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CD40 Ligand/TNFSF5 Antibody

  • CD154 antigen
  • CD154
  • CD40 antigen ligand
  • CD40 Ligand
  • CD40-L
  • CD40LG
  • CD40LIGM
  • gp39
  • hCD40L
  • HIGM1
  • T-B cell-activating molecule
  • T-BAM
  • T-cell antigen Gp39
  • TNF-related activation protein
  • TNFSF5
  • TRAP
  • TRAPtumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome)
  • tumor necrosis factor (ligand) superfamily member 5
  • Tumor necrosis factor ligand superfamily member 5


CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1375 BC071754.1 1-1375 1376-1599 X67878.1 1349-1572 1600-1834 BC071754.1 1596-1830


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
Species: Hu
Applications: WB, AgAct
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD40 Ligand/TNFSF5 Antibody (NBP1-59186) (0)

There are no publications for CD40 Ligand/TNFSF5 Antibody (NBP1-59186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD40 Ligand/TNFSF5 Antibody (NBP1-59186) (0)

There are no reviews for CD40 Ligand/TNFSF5 Antibody (NBP1-59186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD40 Ligand/TNFSF5 Antibody (NBP1-59186). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for paired ABs for use in detecting CD40L (rat) by ELISA. Do you have such a reagent(s) available?
    • Unfortunately we currently do not have any CD40 Ligand antibody pairs that have been validated in Rat. The only antibody pairs we offer for CD40L are validated in Human. I apologize for this inconvenience. If you would be interested in testing one of our products in Rat I'd like to invite you to participate in our Innovators Reward Program. Please contact us at with any questions regarding this program.

Secondary Antibodies


Isotype Controls

Additional CD40 Ligand/TNFSF5 Products

Bioinformatics Tool for CD40 Ligand/TNFSF5 Antibody (NBP1-59186)

Discover related pathways, diseases and genes to CD40 Ligand/TNFSF5 Antibody (NBP1-59186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD40 Ligand/TNFSF5 Antibody (NBP1-59186)

Discover more about diseases related to CD40 Ligand/TNFSF5 Antibody (NBP1-59186).

Pathways for CD40 Ligand/TNFSF5 Antibody (NBP1-59186)

View related products by pathway.

PTMs for CD40 Ligand/TNFSF5 Antibody (NBP1-59186)

Learn more about PTMs related to CD40 Ligand/TNFSF5 Antibody (NBP1-59186).

Research Areas for CD40 Ligand/TNFSF5 Antibody (NBP1-59186)

Find related products by research area.

Blogs on CD40 Ligand/TNFSF5

There are no specific blogs for CD40 Ligand/TNFSF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD40 Ligand/TNFSF5 Antibody and receive a gift card or discount.


Gene Symbol CD40LG