| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLREL |
| Marker | Endothelial Cell Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD36 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD36 Antibody (NBP1-83922)Find related products by research area.
|
|
The affects of Perilipin 2 on diet and metabolism Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo... Read full blog post. |
|
Scavenger's Helper - SR-BI (scavenger receptor class B member 1, SCARB1) SR-B1 belongs to the CD36 scavenger receptor family and serves as a receptor for several ligands including phospholipids, cholesterol ester, lipoproteins, phosphatidylserine, and caveolae localized HDL. It is expressed in endothelial cells, macrophage... Read full blog post. |
|
How do Lipase A and the CD36 Antibody Relate to Each Other Obesity, diabetes and metabolic disorders are dramatically on the increase, linked to disorders such as heart disease, stroke and cancer. To combat this, research groups are studying metabolism at both a cellular and a systemic level. Although we at N... Read full blog post. |
|
ABCA1 Mutations: A Risk Factor in Atherosclerosis Related Strokes The ATP Binding Cassette Transporter (ABCA1) gene encodes the cholesterol regulatory efflux protein, which plays a key role in lipid metabolism. ABCA1 antibody products are an important part of any antibody catalog covering atherosclerosis disease res... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD36 |