CD21 Antibody

Images

 
Western Blot: CD21 Antibody [NBP2-38895] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. ...read more
Immunocytochemistry/ Immunofluorescence: CD21 Antibody [NBP2-38895] - Staining of human lymph node shows strong membranous positivity in germinal center cells.
Independent Antibodies: Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human endometrium, kidney, lymph node and tonsil using Anti-CD21 antibody NBP2-38895 (A) shows similar protein ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Analysis in human lymph node and endometrium tissues. Corresponding CR2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human lymph node shows strong membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human tonsil shows strong membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human kidney shows very weak membranous positivity in cells in tubules as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD21 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS
Specificity
Specificity of human CD21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD21 Protein (NBP2-38895PEP)
Publications
Read Publication using
NBP2-38895 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD21 Antibody

  • C3DR
  • C3DRSLEB9
  • CD21 antigen
  • CD21
  • Complement C3d receptor
  • complement component (3d/Epstein Barr virus) receptor 2
  • complement receptor type 2
  • CR2
  • EBV receptor
  • Epstein-Barr virus receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1107
Species: Mu
Applications: WB, IHC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-44520
Species: Hu, Ca(-), Rt(-)
Applications: WB, Flow, IHC, IHC-P, Flow-IC, IF
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, KD
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
AF3846
Species: Hu, Mu, Rt
Applications: WB, IHC
H00347527-P01
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-38895
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD21 Antibody (NBP2-38895)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CD21 Antibody (NBP2-38895) (0)

There are no reviews for CD21 Antibody (NBP2-38895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CD21 Antibody (NBP2-38895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CD21 Products

Bioinformatics Tool for CD21 Antibody (NBP2-38895)

Discover related pathways, diseases and genes to CD21 Antibody (NBP2-38895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD21 Antibody (NBP2-38895)

Discover more about diseases related to CD21 Antibody (NBP2-38895).
 

Pathways for CD21 Antibody (NBP2-38895)

View related products by pathway.

PTMs for CD21 Antibody (NBP2-38895)

Learn more about PTMs related to CD21 Antibody (NBP2-38895).
 

Research Areas for CD21 Antibody (NBP2-38895)

Find related products by research area.

Blogs on CD21.

How to identify B cell subsets using flow cytometry
By Victoria OsinskiUsing flow cytometry to identify B cell subsetsIdentifying cellular subsets by flow cytometry requires careful and thorough planning in order to ensure the correct subset of cells are identified a...  Read full blog post.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CR2
Uniprot