CD20 Antibody


Immunocytochemistry/ Immunofluorescence: CD20 Antibody [NBP1-90052] Staining of human cell line U-2 OS shows positivity in nucleoli.
Immunohistochemistry-Paraffin: CD20 Antibody [NBP1-90052] - Staining of human tonsil shows strong cytoplasmic positivity in lymphoid cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CD20 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD20 Recombinant Protein Antigen (NBP1-90052PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD20 Antibody

  • B1
  • B-lymphocyte antigen CD20
  • B-lymphocyte cell-surface antigen B1
  • B-lymphocyte surface antigen B1
  • Bp35
  • Bp35MGC3969
  • CD20 antigen
  • CD20 receptor
  • CD20
  • CD20S7
  • CVID5
  • LEU-16
  • Leukocyte surface antigen Leu-16
  • Ly-44
  • Membrane-spanning 4-domains subfamily A member 1
  • membrane-spanning 4-domains, subfamily A, member 1
  • MS4A1
  • MS4A2
  • S7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, PLA
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD20 Antibody (NBP1-90052) (0)

There are no publications for CD20 Antibody (NBP1-90052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD20 Antibody (NBP1-90052) (0)

There are no reviews for CD20 Antibody (NBP1-90052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CD20 Antibody (NBP1-90052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD20 Products

Bioinformatics Tool for CD20 Antibody (NBP1-90052)

Discover related pathways, diseases and genes to CD20 Antibody (NBP1-90052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD20 Antibody (NBP1-90052)

Discover more about diseases related to CD20 Antibody (NBP1-90052).

Pathways for CD20 Antibody (NBP1-90052)

View related products by pathway.

PTMs for CD20 Antibody (NBP1-90052)

Learn more about PTMs related to CD20 Antibody (NBP1-90052).

Research Areas for CD20 Antibody (NBP1-90052)

Find related products by research area.

Blogs on CD20.

CD20 (Cluster of differentiation 20, Membrane-spanning 4-domains subfamily A member 1 (MS4A1), CVID5, B-lymphocyte surface antigen B1)
CD20 is a human B-lymphocyte surface molecule that spans the membrane four times and is expressed on both normal and malignant cells. The CD20 antigen displays a unique expression pattern among hematopoietic cells - it is present on human pre B-ly...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD20 Antibody and receive a gift card or discount.


Gene Symbol MS4A1