CD133 Recombinant Protein Antigen

Images

 
There are currently no images for CD133 Recombinant Protein Antigen (NBP2-59789PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD133 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD133

Source: E.coli

Amino Acid Sequence: LQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTII

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PROM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-59789. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CD133 Recombinant Protein Antigen

  • AC133 Stargardt disease 4 (autosomal dominant)
  • AC133
  • CD133 retinal 2
  • CD133
  • PROM1
  • prominin (mouse)-like 1
  • Prominin 1
  • PROML1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
MAB5248
Species: Hu
Applications: IHC
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CD133 Recombinant Protein Antigen (NBP2-59789PEP) (0)

There are no publications for CD133 Recombinant Protein Antigen (NBP2-59789PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD133 Recombinant Protein Antigen (NBP2-59789PEP) (0)

There are no reviews for CD133 Recombinant Protein Antigen (NBP2-59789PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CD133 Recombinant Protein Antigen (NBP2-59789PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP2-59789PEP

Bioinformatics Tool for CD133 Recombinant Protein Antigen (NBP2-59789PEP)

Discover related pathways, diseases and genes to CD133 Recombinant Protein Antigen (NBP2-59789PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD133 Recombinant Protein Antigen (NBP2-59789PEP)

Discover more about diseases related to CD133 Recombinant Protein Antigen (NBP2-59789PEP).
 

Pathways for CD133 Recombinant Protein Antigen (NBP2-59789PEP)

View related products by pathway.

PTMs for CD133 Recombinant Protein Antigen (NBP2-59789PEP)

Learn more about PTMs related to CD133 Recombinant Protein Antigen (NBP2-59789PEP).
 

Research Areas for CD133 Recombinant Protein Antigen (NBP2-59789PEP)

Find related products by research area.

Blogs on CD133.

ATG9A - early marker autophagosome assembly
ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade...  Read full blog post.

CD133
Also known as PROM1 and AC133, this gene is located on chromosome 4p15 and encodes CD133, a 120kDa pentaspan transmembrane glycoprotein (5-TM) and presents multiple spliced variants. Prominin-1 (CD133) was the first protein identified as "Prominin"; o...  Read full blog post.

CD Antibodies Uncover Markers for Rare Breast Cancer
We at Novus Biologicals have added several new products to our CD antibody database. The CD, or Cluster of Differential proteins are a family of type I transmembrane glycoproteins widely expressed in immune cell populations. These include B cells, thy...  Read full blog post.

Customers Who Bought This Also Bought

CD133 Antibody
NB120-16518

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD133 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PROM1
Entrez