CCRL2/CRAM-A/B Antibody - BSA Free

Immunohistochemistry-Paraffin: CCRL2/CRAM-A/B Antibody [NBP1-85588] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and cells in white pulp.

Analysis in human cell line HEL.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCRL2/CRAM-A/B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCRL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCRL2/CRAM-A/B Protein (NBP1-85588PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCRL2/CRAM-A/B Antibody - BSA Free

• ACKR5
• C-C chemokine receptor-like 2
• CCR11
• CCR6
• CCRL2
• CCRL2/CRAM-A/B
• chemokine (C-C motif) receptor-like 2
• Chemokine receptor CCR11
• Chemokine receptor X
• CKRX
• CKRXMGC116710
• CRAM
• CRAMA
• CRAM-A
• CRAMB
• CRAM-B
• FLJ55815
• HCR
• HCRMGC34104
• Putative MCP-1 chemokine receptor

Background

CCRL2 encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCRL2