CCR11 Antibody - BSA Free

Western Blot: CCR11 Antibody [NBP1-79925] - 293T cell Lysate, concentration 1ug/ml.

Immunohistochemistry-Paraffin: CCR11 Antibody [NBP1-79925] - Sample Type: human colon tissues infected ex-vivo with HIV-1, Green: Primary, Blue: DAPI, Primary Dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit AF 488, Secondary Dilution: 1:500, Image Submitted By: Chiara Foglieni, San Raffaele Scientific Inst

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CCR11 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence SIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACKR4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CCR11 Antibody - BSA Free

• ACKR4
• CC chemokine receptor-like 1
• C-C CKR-11
• CCBP2CCX CKR
• CC-CKR-11
• CCR11
• CCR11CCR10
• CCRL1
• CCX-CKR
• chemokine (C-C motif) receptor-like 1
• orphan seven-transmembrane receptor, chemokine related
• PPR1
• PPR1cc motif, receptor-like protein 1
• VSHK1
• VSHK1CKR-11

Background

CCR11 is a G protein-coupled, seven-transmembrane receptor protein that plays a role in the chemotaxis and trafficking of leukocytes. Showing similar binding affinities as does CCR2 and CCR10 (1,2), CCR11 has been shown to specifically bind the MCP- (monocyte chemoattractant protein) family of chemokines, including MCP-4, MCP-2, and MCP-1. It was also shown to bind eotaxin (3). Though CCR11 shares functional similarity to CCR2 because it recognizes members of the MCP family, CCR11 has a distinct expression pattern (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACKR4
• Uniprot:
  • NP_057641()