CCL18/PARC Antibody - BSA Free

Images

 
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Host: Rabbit. Target Name: CCL18. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: CCL18/PARC Antibody [NBP1-79940] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X ...read more
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: CCL18/PARC Antibody [NBP1-79940] - Host: Rabbit. Target: CCL18. Positive control (+): Human lung (LU). Negative control (-): HepG2 (HG). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

CCL18/PARC Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human CCL18. Peptide sequence PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCL18
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Theoretical MW
10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-79940 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CCL18/PARC Antibody - BSA Free

  • Alternative macrophage activation-associated CC chemokine 1
  • AMAC-1
  • AMAC1CC chemokine ligand 18
  • AMAC-1Small-inducible cytokine A18
  • CCL18
  • chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
  • CKb7
  • DC-CK1
  • DC-CK1CC chemokine PARC
  • DCCK1Macrophage inflammatory protein 4
  • Dendritic cell chemokine 1
  • MIP4
  • MIP-4
  • MIP-4C-C motif chemokine 18
  • PARC
  • PARCPulmonary and activation-regulated chemokine
  • SCYA18chemokine (C-C), dendritic
  • small inducible cytokine A18
  • small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated

Background

CCL18 - chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53281
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PA, WB
DCP00
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
MCC170
Species: Mu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
DMD00
Species: Hu
Applications: ELISA
MMA00
Species: Mu
Applications: ELISA
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DM3A00
Species: Hu
Applications: ELISA
361-MI
Species: Hu
Applications: BA
DIP100
Species: Hu
Applications: ELISA
MME00
Species: Mu
Applications: ELISA
DY327
Species: Hu
Applications: ELISA
DCX900
Species: Hu
Applications: ELISA

Publications for CCL18/PARC Antibody (NBP1-79940)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for CCL18/PARC Antibody (NBP1-79940) (0)

There are no reviews for CCL18/PARC Antibody (NBP1-79940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCL18/PARC Antibody (NBP1-79940). (Showing 1 - 1 of 1 FAQs).

  1. One customer is interested in that Ab: Macrophage Inflammatory Protein 4 Antibody - NBP1-79940 Please, I will be very grateful if you indicate me: - The concentration of the current lot. - Do you have previously news about the use of this Ab in IHC-P with human lung and arterial tissue samples?. Also, any recent bibliographic publication?. - Which other positive control, apart intestinal tissue, you recommend for IHC-P?. - Which detection system you recommend for IHC-P for that Ab?, which is it the exactlly one that you have employed at the image the image that you have at the data sheet?-
    • Thank you very much for your kind note and for sharing your customer's query on our Macrophage Inflammatory Protein 4 antibody (NBP1-79940). The point wise answer to your query is as follows: Q1. The concentration of the current lot. Answer: This product is sold in its lyophilized form and the concentration will not be relevant to the vial. The unit size is 0.05 mg and the customer can reconstitute the vial as: centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50ul of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1 mg/ml in PBS buffer. Q2. Do you have previously news about the use of this Ab in IHC-P with human lung and arterial tissue samples?. Also, any recent bibliographic publication?. Answer: No, we do not know of anyone citing this product yet, and we do not have any customer feedback on your mentioned tissues. Lung is one of the tissues where this target is expressed well, and we are confident that the antibody will detect the protein in lung sections. Q3. Which other positive control, apart intestinal tissue, you recommend for IHC-P?. Answer: From Uniprot, we can see that lung, lymph nodes, placenta or bone marrow would be of great choice as positive controls. Further, the customer may look at the following papers to see how other researchers performed Macrophage Inflammatory Protein 4 (CCL18) staining in different tissues: PMID 24011266, PMID 23433718, and PMID 11590198. Q4. Which detection system you recommend for IHC-P for that Ab?, which is it the exactlly one that you have employed at the image the image that you have at the data sheet? Answer: DAB based detection system was used for the final development of the staining.

Secondary Antibodies

 

Isotype Controls

Additional CCL18/PARC Products

Research Areas for CCL18/PARC Antibody (NBP1-79940)

Find related products by research area.

Blogs on CCL18/PARC

There are no specific blogs for CCL18/PARC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL18/PARC Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL18
Uniprot