Home » TOP2A » TOP2A Antibodies » TOP2A Antibody

TOP2A Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TOP2A Antibody [NBP1-86928] - Analysis in human cell line RH-30.
Western Blot: TOP2A Antibody [NBP1-86928] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: TOP2A Antibody [NBP1-86928] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining in human testis and kidney tissues using anti-TOP2A antibody. Corresponding TOP2A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining of human lymph node shows strong nuclear positivity in reaction center cells
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TOP2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG
Specificity
Specificity of human TOP2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOP2A Recombinant Protein Antigen (NBP1-86928PEP)
Publications
Read Publications using NBP1-86928.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23470167)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOP2A Antibody

  • DNA topoisomerase (ATP-hydrolyzing)
  • DNA topoisomerase 2-alpha
  • DNA topoisomerase II, 170 kD
  • DNA topoisomerase II, alpha isozyme
  • EC 5.99.1.3
  • TOP2
  • TOP2A
  • TOP2DNA gyrase
  • topoisomerase (DNA) II alpha (170kD)
  • topoisomerase (DNA) II alpha 170kDa
  • TP2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PARC Antibody
NBP1-77222
Western Blot: PARC Antibody [NBP1-77222] - Daudi lysate with PARC antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry: PARC Antibody [NBP1-77222] - Daudi cells with PARC antibody at 1 ug/ml.
Immunofluorescence: PARC Antibody [NBP1-77222] - Immunofluorescence of Bcl-G in Daudi cells with Bcl-G antibody at 2 ug/mL.
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
Recombinant Human ErbB2/Her2 Fc Chimera (Catalog # 1129-ER) blocks anti-ErbB2 mediated inhibition of the SK‑BR‑3 human breast cancer cell line. The ED50 is 20-80 ng/mL in the presence of 0.6 μg/mL Goat Anti-Human ErbB2/Her2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1129)
(6 Reviews)
(28 Publications)
Species: Hu
NOV/CCN3 Antibody
AF1640
NOV/CCN3 was detected in immersion fixed paraffin-embedded sections of human renal cancer tissue using Goat Anti-Human NOV/CCN3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1640) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
Plexin A1 Antibody
[Unconjugated]
AF4309
Western blot shows lysates of mouse embryonic heart tissue. PVDF Membrane was probed with 1 µg/mL of Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A1 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Plexin A1 was detected in immersion fixed frozen sections of embryonic mouse spinal cord using Mouse Plexin A1 Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Plexin A1 was detected in immersion fixed immature human dendritic cells using Goat Anti-Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu, Mu
Applications: WB, IHC, ICC
RPL10 Antibody
NBP1-84037
Western Blot: RPL10 Antibody [NBP1-84037] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining in human fallopian tube and cerebral cortex tissues. Corresponding RPL10 RNA-seq data are presented for the same tissues.
Western Blot: RPL10 Antibody [NBP1-84037] - Analysis in human cell line HeLa.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Tyrosinase
Antibody (T311)
NBP2-25238
Immunohistochemistry-Paraffin: Tyrosinase Antibody (T311) [NBP2-25238] - Formalin-paraffin melanoma (20X) stained with Tyrosinase Ab (T311).
Immunohistochemistry-Paraffin: Tyrosinase Antibody (T311) [NBP2-25238] - Formalin-paraffin melanoma (10X) stained with Tyrosinase Ab (T311).
SDS-Page: Tyrosinase Antibody (T311) [NBP2-25238]
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
RFC2 Antibody
(OTI2B2)
NBP2-45570
Western Blot: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Immunohistochemistry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by RFC2 antibody.
Species: Hu
Applications: WB, Flow, IHC
RFC1 Antibody
[Unconjugated]
AF6457
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc).  PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human RFC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6457) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RFC1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
RFC4 Antibody
NBP2-48927
Western Blot: RFC4 Antibody [NBP2-48927] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunocytochemistry/Immunofluorescence: RFC4 Antibody [NBP2-48927] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RFC4 Antibody [NBP2-48927] - Staining in human testis and kidney tissues using anti-RFC4 antibody. Corresponding RFC4 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunocytochemistry/Immunofluorescence: Rad51 Antibody (14B4) [NB100-148] - staning of RAD51 nuclear foci in U2OS cells using RAD51 14B4 antibody. Cells were pre-extracted with CSK buffer before fixation with 4% PFA. RAD51 14B4 was used at 1:1000 dultion. DAPI was used to counterstain the nucleus. Scale bar, 10 mciro-meter.
Immunohistochemistry-Paraffin: Rad51 Antibody (14B4) [NB100-148] - Detects RAD51 in nucleus on BT483 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded BT483 xenograft. RAD51 antibody 14B4 at a dilution of 1:200.
(3 Reviews)
(38 Publications)
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebral cortex shows high expression.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Topoisomerase I
Antibody
NBP1-90365
Western Blot: Topoisomerase I Antibody [NBP1-90365] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Topoisomerase I Antibody [NBP1-90365] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining in human appendix and skeletal muscle tissues using anti-TOP1 antibody. Corresponding TOP1 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TOP2B Antibody
NBP1-89527
Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: TOP2B Antibody [NBP1-89527] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human pancreas shows moderate nuclear positivity.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NHE6/SLC9A6
Antibody
NBP2-32463
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-32463] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-32463] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-32463] - Staining in human cerebral cortex and liver tissues using anti-SLC9A6 antibody. Corresponding SLC9A6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
HSP60 Antibody
NBP1-77397
Western Blot: HSP60 Antibody [NBP1-77397] - Western blot analysis of extracts from HeLa and COS cells using NBP1-77397 Hsp60 antibody at 1:1000
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - Confocal immunofluorescent analysis of HeLa cells using Hsp60 antibody (NBP1-77397, 1:100). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green, A). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red, B). DAPI was used to stain the cell nuclei (blue, C).
Immunohistochemistry: HSP60 Antibody [NBP1-77397] - IHC staining of HSP60 in human kidney carcinoma using DAB with hematoxylin counterstain.
(4 Reviews)
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P

Publications for TOP2A Antibody (NBP1-86928)(2)


Reviews for TOP2A Antibody (NBP1-86928) (0)

There are no reviews for TOP2A Antibody (NBP1-86928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOP2A Antibody (NBP1-86928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TOP2A Antibody (NBP1-86928)

Discover related pathways, diseases and genes to TOP2A Antibody (NBP1-86928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOP2A Antibody (NBP1-86928)

Discover more about diseases related to TOP2A Antibody (NBP1-86928).
 

Pathways for TOP2A Antibody (NBP1-86928)

View related products by pathway.

PTMs for TOP2A Antibody (NBP1-86928)

Learn more about PTMs related to TOP2A Antibody (NBP1-86928).
 

Research Areas for TOP2A Antibody (NBP1-86928)

Find related products by research area.

Blogs on TOP2A

There are no specific blogs for TOP2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOP2A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TOP2A
Entrez