Home » TOP2A » TOP2A Antibodies » TOP2A Antibody

TOP2A Antibody

 (2 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TOP2A Antibody [NBP1-86928] - MDA-MB-231 and MCF-7 whole cell lysates were loaded (40 ug/lane). 10% SDS-PAGE. TOP2A Antibody (NBP1-86928) primary antibody at 1:1000, 4C, overnight. WB image submitted by a verified customer review.
Western Blot: TOP2A Antibody [NBP1-86928] - MDA-MB-231 and MCF-7 whole cell lysates were loaded (40 ug/lane). 10% SDS-PAGE. TOP2A Antibody (NBP1-86928) primary antibody at 1:1000, 4C, overnight. WB image submitted by a ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining in human testis and kidney tissues using anti-TOP2A antibody. Corresponding TOP2A RNA-seq data are presented for the ...read more
Western Blot: TOP2A Antibody [NBP1-86928] - Analysis in human cell line RH-30.
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

TOP2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TOP2A Recombinant Protein Antigen (NBP1-86928PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86928 in the following applications:
Publications
Read Publications using NBP1-86928.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOP2A Antibody

  • DNA topoisomerase (ATP-hydrolyzing)
  • DNA topoisomerase 2-alpha
  • DNA topoisomerase II, 170 kD
  • DNA topoisomerase II, alpha isozyme
  • EC 5.99.1.3
  • TOP2
  • TOP2A
  • TOP2DNA gyrase
  • topoisomerase (DNA) II alpha (170kD)
  • topoisomerase (DNA) II alpha 170kDa
  • TP2A

Background

Topo II Alpha encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CCL18/PARC [Biotin]
DY394
(32 Publications)
Species: Hu
Applications: ELISA
PARC Antibody -
BSA Free
NBP1-77222
Immunocytochemistry: PARC Antibody [NBP1-77222] - Daudi cells with PARC antibody at 1 ug/ml.
Immunofluorescence: PARC Antibody [NBP1-77222] - Immunofluorescence of Bcl-G in Daudi cells with Bcl-G antibody at 2 ug/mL.
Western Blot: PARC Antibody [NBP1-77222] - Daudi lysate with PARC antibody at (A) 1 and (B) 2 ug/ml.
Species: Hu, Mu
Applications: ELISA, ICC, IF, WB
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(55 Publications)
Species: Hu
Applications: BA
NOV/CCN3 Antibody
AF1640
NOV/CCN3 was detected in immersion fixed paraffin-embedded sections of human renal cancer tissue using Goat Anti-Human NOV/CCN3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1640) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Plexin A1 Antibody
[Unconjugated]
AF4309
Plexin A1 was detected in immersion fixed frozen sections of embryonic mouse spinal cord using Mouse Plexin A1 Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Plexin A1 was detected in immersion fixed immature human dendritic cells using Goat Anti-Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of mouse embryonic heart tissue. PVDF Membrane was probed with 1 µg/mL of Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A1 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(5 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
RPL10 Antibody
NBP1-84037
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RFC2 Antibody
(OTI2B2) - Azide and ...
NBP2-73857
Western Blot: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Flow Cytometry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by RFC2 antibody.
Immunohistochemistry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of Adenocarcinoma of Human endometrium tissue.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc).  PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human RFC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6457) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RFC1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
RFC4 Antibody
(OTI1A8)
NBP2-45946
Immunocytochemistry/Immunofluorescence: RFC4 Antibody (OTI1A8) [NBP2-45946] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY RFC4.
Immunohistochemistry: RFC4 Antibody (OTI1A8) [NBP2-45946] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: RFC4 Antibody (OTI1A8) [NBP2-45946] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
(5 Reviews)
(60 Publications)
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human kidney shows strong cytoplasmic postivity in cells in tubules.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Topoisomerase I
Antibody
NBP1-90365
Immunocytochemistry/Immunofluorescence: Topoisomerase I Antibody [NBP1-90365] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Analysis in human placenta and skeletal muscle tissues. Corresponding TOP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
TOP2B Antibody
NBP1-89527
Immunocytochemistry/Immunofluorescence: TOP2B Antibody [NBP1-89527] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NHE6/SLC9A6
Antibody
NBP2-38877
Immunocytochemistry/Immunofluorescence: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HSP60 Antibody -
BSA Free
NBP1-77397
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody conjugated to Alexa Fluor 488 (NBP1-77397AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody - BSA Free [NBP1-77397] - Mouse MS1 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 2ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(4 Reviews)
(5 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
TOP2A Antibody
NBP1-86928
TOP2A Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TOP2A Antibody (NBP1-86928)(2)


Review for TOP2A Antibody (NBP1-86928) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86928:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TOP2A NBP1-86928
Enlarge 		5
reviewed by:
Verified Customer
 WB Human 03/06/2021
View

Summary

ApplicationWestern Blot
Sample TestedBREAST CANCER CELL LINES, Sample Amount: 40 ug
SpeciesHuman
LotA115216

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOP2A Antibody (NBP1-86928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOP2A Products

Bioinformatics Tool for TOP2A Antibody (NBP1-86928)

Discover related pathways, diseases and genes to TOP2A Antibody (NBP1-86928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOP2A Antibody (NBP1-86928)

Discover more about diseases related to TOP2A Antibody (NBP1-86928).
 

Pathways for TOP2A Antibody (NBP1-86928)

View related products by pathway.

PTMs for TOP2A Antibody (NBP1-86928)

Learn more about PTMs related to TOP2A Antibody (NBP1-86928).
 

Research Areas for TOP2A Antibody (NBP1-86928)

Find related products by research area.

Blogs on TOP2A

There are no specific blogs for TOP2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Western Blot TOP2A NBP1-86928
Enlarge
 Verified Customer
03/06/2021
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol TOP2A