TOP2A Antibody

Images

 
Western Blot: TOP2A Antibody [NBP1-86928] - MDA-MB-231 and MCF-7 whole cell lysates were loaded (40 ug/lane). 10% SDS-PAGE. TOP2A Antibody (NBP1-86928) primary antibody at 1:1000, 4C, overnight. WB image submitted by a ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining in human testis and kidney tissues using anti-TOP2A antibody. Corresponding TOP2A RNA-seq data are presented for the ...read more
Western Blot: TOP2A Antibody [NBP1-86928] - Analysis in human cell line RH-30.
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: TOP2A Antibody [NBP1-86928] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TOP2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TOP2A Recombinant Protein Antigen (NBP1-86928PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86928 in the following applications:

Publications
Read Publications using NBP1-86928.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOP2A Antibody

  • DNA topoisomerase (ATP-hydrolyzing)
  • DNA topoisomerase 2-alpha
  • DNA topoisomerase II, 170 kD
  • DNA topoisomerase II, alpha isozyme
  • EC 5.99.1.3
  • TOP2
  • TOP2A
  • TOP2DNA gyrase
  • topoisomerase (DNA) II alpha (170kD)
  • topoisomerase (DNA) II alpha 170kDa
  • TP2A

Background

Topo II Alpha encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY394
Species: Hu
Applications: ELISA
NBP1-77222
Species: Hu, Mu
Applications: ELISA, ICC, IF, WB
1129-ER
Species: Hu
Applications: BA
AF1640
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-90365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NBP1-89527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-86928
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TOP2A Antibody (NBP1-86928)(2)

Review for TOP2A Antibody (NBP1-86928) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86928:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TOP2A NBP1-86928
Enlarge
5
reviewed by:
Verified Customer
WB Human 03/06/2021
View

Summary

ApplicationWestern Blot
Sample TestedBREAST CANCER CELL LINES, Sample Amount: 40 ug
SpeciesHuman
LotA115216

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOP2A Antibody (NBP1-86928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOP2A Products

Bioinformatics Tool for TOP2A Antibody (NBP1-86928)

Discover related pathways, diseases and genes to TOP2A Antibody (NBP1-86928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOP2A Antibody (NBP1-86928)

Discover more about diseases related to TOP2A Antibody (NBP1-86928).
 

Pathways for TOP2A Antibody (NBP1-86928)

View related products by pathway.

PTMs for TOP2A Antibody (NBP1-86928)

Learn more about PTMs related to TOP2A Antibody (NBP1-86928).
 

Research Areas for TOP2A Antibody (NBP1-86928)

Find related products by research area.

Blogs on TOP2A

There are no specific blogs for TOP2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
03/06/2021
Application: WB
Species: Human

Bioinformatics

Gene Symbol TOP2A