CCL1/I-309/TCA-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CCL1/I-309/TCA-3 Antibody [NBP2-14459] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCL1/I-309/TCA-3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCL1/I-309/TCA-3 Protein (NBP2-14459PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCL1/I-309/TCA-3 Antibody - BSA Free

• C-C motif chemokine 1
• CCL1
• chemokine (C-C motif) ligand 1
• I-309
• inflammatory cytokine I-309
• P500
• SCYA1
• SCYA1Small-inducible cytokine A1
• SCYA2
• SISe
• small inducible cytokine A1 (I-309, homologous to mouse Tca-3)
• T lymphocyte-secreted protein I-309
• TCA3
• TCA-3

Background

SCYA1 is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL1