Cathepsin D Antibody

Images

 
Western Blot: Cathepsin D Antibody [NBP1-85562] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: Cathepsin D Antibody [NBP1-85562] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cathepsin D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT
Marker
Lysosomes Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cathepsin D Protein (NBP1-85562PEP)
Publications
Read Publication using NBP1-85562.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cathepsin D Antibody

  • cathepsin D (lysosomal aspartyl protease)
  • Cathepsin D
  • CPSD
  • CTSD
  • EC 3.4.23
  • EC 3.4.23.5
  • lysosomal aspartyl peptidase
  • lysosomal aspartyl protease
  • MGC2311
  • neuronal 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF6144
Species: Hu
Applications: WB, Simple Western
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB400-152
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF1013
Species: Mu
Applications: WB, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA

Publications for Cathepsin D Antibody (NBP1-85562)(1)

Reviews for Cathepsin D Antibody (NBP1-85562) (0)

There are no reviews for Cathepsin D Antibody (NBP1-85562). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin D Antibody (NBP1-85562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin D Products

Bioinformatics Tool for Cathepsin D Antibody (NBP1-85562)

Discover related pathways, diseases and genes to Cathepsin D Antibody (NBP1-85562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin D Antibody (NBP1-85562)

Discover more about diseases related to Cathepsin D Antibody (NBP1-85562).
 

Pathways for Cathepsin D Antibody (NBP1-85562)

View related products by pathway.

PTMs for Cathepsin D Antibody (NBP1-85562)

Learn more about PTMs related to Cathepsin D Antibody (NBP1-85562).
 

Research Areas for Cathepsin D Antibody (NBP1-85562)

Find related products by research area.

Blogs on Cathepsin D

There are no specific blogs for Cathepsin D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSD
Entrez