TFF1/pS2 Antibody

Images

 
Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFF1/pS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TFF1/pS2 Protein (NBP1-90813PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-90813 in the following applications:

Publications
Read Publications using NBP1-90813.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFF1/pS2 Antibody

  • BCEI
  • BCEIbreast cancer, estrogen-inducible sequence expressed in
  • Breast cancer estrogen-inducible protein
  • breast cancer estrogen-inducible sequence
  • D21S21
  • gastrointestinal trefoil protein pS2
  • hP1.A
  • HPS2
  • PNR-2
  • Polypeptide P1.A
  • Protein pS2
  • PS2
  • TFF1
  • trefoil factor 1
  • trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB4077
Species: Hu
Applications: WB, IHC
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TFF1/pS2 Antibody (NBP1-90813)(4)

Review for TFF1/pS2 Antibody (NBP1-90813) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-90813:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TFF1/pS2 NBP1-90813
Enlarge
reviewed by:
Shilpa Agarwal
WB Human 12/09/2014
View

Summary

ApplicationWestern Blot
Sample TestedLysate from HEK293 cells
SpeciesHuman

Blocking

Blocking DetailsNon-fat dry milk (5%) in 1X PBS

Primary Anitbody

Dilution Ratio1:1000 dilution, 3 hrs at RT in 5% non-fat dry milk

Secondary Antibody

Secondary Descriptionanti rabbit HRP-conjugated antibody
Secondary Manufacturer Cat#Life Technologies # 65-6120
Secondary Concentration1:10,000

Details

Detection NotesSuperSignal West Pico Chemiluminescent Substrate (Thermo), 30 sec exposure using X-ray film

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFF1/pS2 Antibody (NBP1-90813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFF1/pS2 Products

Bioinformatics Tool for TFF1/pS2 Antibody (NBP1-90813)

Discover related pathways, diseases and genes to TFF1/pS2 Antibody (NBP1-90813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFF1/pS2 Antibody (NBP1-90813)

Discover more about diseases related to TFF1/pS2 Antibody (NBP1-90813).
 

Pathways for TFF1/pS2 Antibody (NBP1-90813)

View related products by pathway.

PTMs for TFF1/pS2 Antibody (NBP1-90813)

Learn more about PTMs related to TFF1/pS2 Antibody (NBP1-90813).
 

Research Areas for TFF1/pS2 Antibody (NBP1-90813)

Find related products by research area.

Blogs on TFF1/pS2

There are no specific blogs for TFF1/pS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Shilpa Agarwal
12/09/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol TFF1
Entrez