TFF1/pS2 Antibody


Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in ysate from HEK293 cells. Image from a verified customer review.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining in human stomach and liver tissues using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the more
Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in control (vector only transfected HEK293T lysate) and TFF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Orthogonal Strategies: Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in human cell lines MCF-7 and A-431 using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same cell lines. more
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human stomach shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

TFF1/pS2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Specificity of human TFF1/pS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in a verified customer review.
Control Peptide
TFF1/pS2 Protein (NBP1-90813PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-90813 in the following applications:

Read Publications using NBP1-90813.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TFF1/pS2 Antibody

  • BCEI
  • BCEIbreast cancer, estrogen-inducible sequence expressed in
  • Breast cancer estrogen-inducible protein
  • breast cancer estrogen-inducible sequence
  • D21S21
  • gastrointestinal trefoil protein pS2
  • hP1.A
  • HPS2
  • PNR-2
  • Polypeptide P1.A
  • Protein pS2
  • PS2
  • TFF1
  • trefoil factor 1
  • trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Mu
Applications: WB, IHC, IP, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Pm, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC

Publications for TFF1/pS2 Antibody (NBP1-90813)(4)

Review for TFF1/pS2 Antibody (NBP1-90813) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-90813:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot TFF1/pS2 NBP1-90813
reviewed by:
Shilpa Agarwal
WB Human 12/09/2014


ApplicationWestern Blot
Sample TestedLysate from HEK293 cells


Blocking DetailsNon-fat dry milk (5%) in 1X PBS

Primary Anitbody

Dilution Ratio1:1000 dilution, 3 hrs at RT in 5% non-fat dry milk

Secondary Antibody

Secondary Descriptionanti rabbit HRP-conjugated antibody
Secondary Manufacturer Cat#Life Technologies # 65-6120
Secondary Concentration1:10,000


Detection NotesSuperSignal West Pico Chemiluminescent Substrate (Thermo), 30 sec exposure using X-ray film

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFF1/pS2 Antibody (NBP1-90813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TFF1/pS2 Products

Bioinformatics Tool for TFF1/pS2 Antibody (NBP1-90813)

Discover related pathways, diseases and genes to TFF1/pS2 Antibody (NBP1-90813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFF1/pS2 Antibody (NBP1-90813)

Discover more about diseases related to TFF1/pS2 Antibody (NBP1-90813).

Pathways for TFF1/pS2 Antibody (NBP1-90813)

View related products by pathway.

PTMs for TFF1/pS2 Antibody (NBP1-90813)

Learn more about PTMs related to TFF1/pS2 Antibody (NBP1-90813).

Research Areas for TFF1/pS2 Antibody (NBP1-90813)

Find related products by research area.

Blogs on TFF1/pS2

There are no specific blogs for TFF1/pS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Shilpa Agarwal
Application: WB
Species: Human


Gene Symbol TFF1