
Western Blot: CART/CARTPT Antibody [NBP1-91749] - Analysis in control (vector only transfected HEK293T lysate) and CARTPT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining of human adrenal gland shows strong cytoplasmic positivity in cells in medullary cells.
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining in human adrenal gland and pancreas tissues using anti-CARTPT antibody. Corresponding CARTPT RNA-seq data are more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

CART/CARTPT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF
Specificity of human CART/CARTPT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CART/CARTPT Protein (NBP1-91749PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CART/CARTPT Antibody

  • CART prepropeptide
  • CART
  • CARTcocaine and amphetamine regulated transcript
  • cocaine- and amphetamine-regulated transcript protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CART/CARTPT Antibody (NBP1-91749) (0)

There are no publications for CART/CARTPT Antibody (NBP1-91749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CART/CARTPT Antibody (NBP1-91749) (0)

There are no reviews for CART/CARTPT Antibody (NBP1-91749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CART/CARTPT Antibody (NBP1-91749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CART/CARTPT Antibody (NBP1-91749)

Discover related pathways, diseases and genes to CART/CARTPT Antibody (NBP1-91749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CART/CARTPT Antibody (NBP1-91749)

Discover more about diseases related to CART/CARTPT Antibody (NBP1-91749).

Pathways for CART/CARTPT Antibody (NBP1-91749)

View related products by pathway.

PTMs for CART/CARTPT Antibody (NBP1-91749)

Learn more about PTMs related to CART/CARTPT Antibody (NBP1-91749).

Research Areas for CART/CARTPT Antibody (NBP1-91749)

Find related products by research area.


There are no specific blogs for CART/CARTPT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CART/CARTPT Antibody and receive a gift card or discount.


Gene Symbol CARTPT