CART/CARTPT Antibody

Images

 
Western Blot: CART/CARTPT Antibody [NBP1-91749] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: CART/CARTPT Antibody [NBP1-91749] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining in human adrenal gland and pancreas tissues using anti-CARTPT antibody. Corresponding CARTPT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining of human adrenal gland shows strong cytoplasmic positivity in cells in medullary cells.
Immunohistochemistry-Paraffin: CART/CARTPT Antibody [NBP1-91749] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CART/CARTPT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF
Specificity
Specificity of human CART/CARTPT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARTPT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CART/CARTPT Protein (NBP1-91749PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CART/CARTPT Antibody

  • CART prepropeptide
  • CART
  • CARTcocaine and amphetamine regulated transcript
  • CARTPT
  • cocaine- and amphetamine-regulated transcript protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-41273
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13780
Species: Hu
Applications: IHC, IHC-P
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP1-86629
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CART/CARTPT Antibody (NBP1-91749) (0)

There are no publications for CART/CARTPT Antibody (NBP1-91749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CART/CARTPT Antibody (NBP1-91749) (0)

There are no reviews for CART/CARTPT Antibody (NBP1-91749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CART/CARTPT Antibody (NBP1-91749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CART/CARTPT Antibody (NBP1-91749)

Discover related pathways, diseases and genes to CART/CARTPT Antibody (NBP1-91749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CART/CARTPT Antibody (NBP1-91749)

Discover more about diseases related to CART/CARTPT Antibody (NBP1-91749).
 

Pathways for CART/CARTPT Antibody (NBP1-91749)

View related products by pathway.

PTMs for CART/CARTPT Antibody (NBP1-91749)

Learn more about PTMs related to CART/CARTPT Antibody (NBP1-91749).
 

Research Areas for CART/CARTPT Antibody (NBP1-91749)

Find related products by research area.

Blogs on CART/CARTPT

There are no specific blogs for CART/CARTPT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CART/CARTPT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CARTPT
Entrez