Carbonic Anhydrase XII/CA12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Carbonic Anhydrase XII/CA12 Antibody [NBP1-81668] - Staining of human cell line RT4 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Carbonic Anhydrase XII/CA12 Antibody [NBP1-81668] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase XII/CA12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
Specificity
Specificity of human Carbonic Anhydrase XII/CA12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CA12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 26911677).
Control Peptide
Carbonic Anhydrase XII/CA12 Protein (NBP1-81668PEP)
Publications
Read Publications using
NBP1-81668 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22016510)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carbonic Anhydrase XII/CA12 Antibody

  • CA12
  • Carbonate dehydratase XII
  • carbonic anhydrase 12
  • Carbonic Anhydrase XII
  • carbonic anhydrase XIICAXII
  • carbonic dehydratase
  • CA-XII
  • EC 4.2.1.1
  • FLJ20151
  • HsT18816
  • Tumor antigen HOM-RCC-3.1.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, Dual ISH-IHC, KO
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-92743
Species: Hu, Mu
Applications: WB, IHC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
MAB2186
Species: Hu
Applications: WB, IHC, IP
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NB100-41384
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, PEP-ELISA, KD
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF2345
Species: Mu
Applications: WB, IP
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-45354
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668)(5)

Reviews for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668) (0)

There are no reviews for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Carbonic Anhydrase XII/CA12 Products

Bioinformatics Tool for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668)

Discover related pathways, diseases and genes to Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668)

Discover more about diseases related to Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668).
 

Pathways for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668)

View related products by pathway.

PTMs for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668)

Learn more about PTMs related to Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668).
 

Research Areas for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668)

Find related products by research area.

Blogs on Carbonic Anhydrase XII/CA12

There are no specific blogs for Carbonic Anhydrase XII/CA12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase XII/CA12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CA12