Carbonic Anhydrase XIII/CA13 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carbonic Anhydrase XIII/CA13 Antibody [NBP1-86606] - Staining in human small intestine and lymph node tissues using anti-CA13 antibody. Corresponding CA13 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Carbonic Anhydrase XIII/CA13 Antibody [NBP1-86606] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: Carbonic Anhydrase XIII/CA13 Antibody [NBP1-86606] - Staining of human small intestine shows high expression.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Carbonic Anhydrase XIII/CA13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Carbonic Anhydrase XIII/CA13 Antibody - BSA Free (NBP1-86606) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLR
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CA13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Carbonic Anhydrase XIII/CA13 Protein (NBP1-86606PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Carbonic Anhydrase XIII/CA13 Antibody - BSA Free

• CA13
• carbonic anhydrase 13
• Carbonic Anhydrase XIII
• carbonic anhydrase XIIICarbonate dehydratase XIII
• CAXIII
• CA-XIII
• EC 4.2.1.1
• FLJ37995
• MGC59868

Background

Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CA13