CAMTA2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CAMTA2 Antibody [NBP2-56136] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CAMTA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CAMTA2 Antibody - BSA Free (NBP2-56136) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGPERLAHGS
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMTA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CAMTA2 Recombinant Protein Antigen (NBP2-56136PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CAMTA2 Antibody - BSA Free

• calmodulin binding transcription activator 2
• KIAA0909calmodulin-binding transcription activator 2

Background

CAMTA2 is encoded by this gene is a member of the calmodulin-binding transcription activator (CAMTA) protein family. CAMTA family members share a common domain structure that consists of a transcription activation domain, a DNA-binding domain, and a calmodulin-binding domain. CAMTA proteins may function as transcription factors that respond to calcium signaling by directly binding to calmodulin. This protein was shown to possess transcription activation activity in a transcription reporter system in yeast. Alternatively spliced transcript variants have been identified, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMTA2