Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, IHC, IHC-P, S-ELISA |
Clone | 1F8 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | ZNF232 (NP_055334.2, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSP |
Specificity | ZNF232 - zinc finger protein 232 (1F8) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | ZNF232 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Diseases for ZNF232 Antibody (H00007775-M06)Discover more about diseases related to ZNF232 Antibody (H00007775-M06).
| Pathways for ZNF232 Antibody (H00007775-M06)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.