ZNF232 Antibody (1F8)

Images

 
Western Blot: ZNF232 Antibody (1F8) [H00007775-M06] - Analysis of ZNF232 expression in transfected 293T cell line by ZNF232 monoclonal antibody (M06), clone 1F8. Lane 1: ZNF232 transfected lysatE (50.7 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: ZNF232 Antibody (1F8) [H00007775-M06] - Analysis of monoclonal antibody to ZNF232 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Sandwich ELISA: ZNF232 Antibody (1F8) [H00007775-M06] - Detection limit for recombinant GST tagged ZNF232 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF232 Antibody (1F8) Summary

Immunogen
ZNF232 (NP_055334.2, 181 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSP
Specificity
ZNF232 - zinc finger protein 232 (1F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF232
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF232 Antibody (1F8)

  • zinc finger protein 500
  • Zinc finger protein with KRAB and SCAN domains 18
  • ZKSCAN18KIAA0557

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28457
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, ICC
NBP2-56136
Species: Hu
Applications: ICC/IF
NBP1-85978
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-79951
Species: Hu
Applications: WB
H00009098-M01
Species: Hu
Applications: WB, ELISA
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-20385
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
NBP1-90261
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P

Publications for ZNF232 Antibody (H00007775-M06) (0)

There are no publications for ZNF232 Antibody (H00007775-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF232 Antibody (H00007775-M06) (0)

There are no reviews for ZNF232 Antibody (H00007775-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF232 Antibody (H00007775-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF232 Products

Bioinformatics Tool for ZNF232 Antibody (H00007775-M06)

Discover related pathways, diseases and genes to ZNF232 Antibody (H00007775-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF232 Antibody (H00007775-M06)

Discover more about diseases related to ZNF232 Antibody (H00007775-M06).
 

Pathways for ZNF232 Antibody (H00007775-M06)

View related products by pathway.

Blogs on ZNF232

There are no specific blogs for ZNF232, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF232 Antibody (1F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF232
Entrez
Uniprot