![Western Blot: Sperm-associated antigen 7 Antibody [NBP1-90261] - Analysis in control (vector only transfected HEK293T lysate) and SPAG7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/Sperm-associated-antigen-7-Antibody-Western-Blot-NBP1-90261-img0009.jpg "Western Blot: Sperm-associated antigen 7 Antibody [NBP1-90261] - Analysis in control (vector only transfected HEK293T lysate) and SPAG7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAG |
| Predicted Species | Mouse (97%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPAG7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NBP2-37364-img0012.jpg)
-Flow-(Intracellular)-NBP2-37364-img0013.jpg)
-Flow-Cytometry-NBP2-37364-img0014.jpg)
-Immunohistochemistry-Paraffin-H00007775-M06-img0002.jpg)
-Western-Blot-H00007775-M06-img0004.jpg)
-Sandwich-ELISA-H00007775-M06-img0003.jpg)
-NBP2-24530-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for Sperm-associated antigen 7 Antibody (NBP1-90261)Discover more about diseases related to Sperm-associated antigen 7 Antibody (NBP1-90261).
| Pathways for Sperm-associated antigen 7 Antibody (NBP1-90261)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SPAG7 |
![Immunocytochemistry/Immunofluorescence: Sperm-associated antigen 7 Antibody [NBP1-90261] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/Sperm-associated-antigen-7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90261-img0008.jpg "Immunocytochemistry/Immunofluorescence: Sperm-associated antigen 7 Antibody [NBP1-90261] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: Sperm-associated antigen 7 Antibody [NBP1-90261] - Staining of human fallopian tube shows cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/Sperm-associated-antigen-7-Antibody-Immunohistochemistry-Paraffin-NBP1-90261-img0007.jpg "Immunohistochemistry-Paraffin: Sperm-associated antigen 7 Antibody [NBP1-90261] - Staining of human fallopian tube shows cytoplasmic and nuclear positivity in glandular cells.")
![Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_812.jpg)
![Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_813.jpg)
![Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/Adiponectin_DRP300_ELISA_173.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
-Immunohistochemistry-Paraffin-H00006757-M01-img0003.jpg)
-Western-Blot-H00006757-M01-img0005.jpg)
-ELISA-H00006757-M01-img0006.jpg)
-Western-Blot-NBP1-47791-img0018.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-47791-img0008.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-47791-img0010.jpg)
![Immunohistochemistry Axl Antibody [Unconjugated]](https://images.novusbio.com/images2/Axl_AF854_Immunohistochemistry_23170.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")