Sperm-associated antigen 7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Sperm-associated antigen 7 Antibody [NBP1-90261] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Sperm-associated antigen 7 Antibody [NBP1-90261] - Staining of human fallopian tube shows cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sperm-associated antigen 7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sperm-associated antigen 7 Protein (NBP1-90261PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sperm-associated antigen 7 Antibody

  • ACRP
  • FSA-1
  • MGC20134
  • sperm associated antigen 7
  • sperm-associated antigen 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87034
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP1-77089
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00023499-M08
Species: Hu
Applications: WB, ELISA
NBL1-08532
Species: Hu
NBP1-79022
Species: Hu, Mu
Applications: WB, IP
H00006757-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-86822
Species: Hu
Applications: WB, IHC, IHC-P
AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP1-90261
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Sperm-associated antigen 7 Antibody (NBP1-90261) (0)

There are no publications for Sperm-associated antigen 7 Antibody (NBP1-90261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sperm-associated antigen 7 Antibody (NBP1-90261) (0)

There are no reviews for Sperm-associated antigen 7 Antibody (NBP1-90261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Sperm-associated antigen 7 Antibody (NBP1-90261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sperm-associated antigen 7 Products

Bioinformatics Tool for Sperm-associated antigen 7 Antibody (NBP1-90261)

Discover related pathways, diseases and genes to Sperm-associated antigen 7 Antibody (NBP1-90261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sperm-associated antigen 7 Antibody (NBP1-90261)

Discover more about diseases related to Sperm-associated antigen 7 Antibody (NBP1-90261).
 

Pathways for Sperm-associated antigen 7 Antibody (NBP1-90261)

View related products by pathway.

Blogs on Sperm-associated antigen 7

There are no specific blogs for Sperm-associated antigen 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sperm-associated antigen 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG7