Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01), clone 5D1.Lane 1: ENO3 transfected lysate(46.9 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi ( Cat # H00002027-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - ENO3 monoclonal antibody (M01), clone 5D1 Analysis of ENO3 expression in HeLa.
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.
ELISA: ENO3 Antibody (5D1) [H00002027-M01] - Detection limit for recombinant GST tagged ENO3 is approximately 0.03ng/ml as a capture antibody.
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Specificity
ENO3 - enolase 3 (beta, muscle)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENO3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. Use in Dot blot reported in scientific literature (PMID:26344128).
Publications
Read Publications using H00002027-M01 in the following applications:
Bovine reactivity reported in multiple pieces of scientific literature.
Packaging, Storage & Formulations
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ENO3 Antibody (5D1) - Azide and BSA Free
2-phospho-D-glycerate hydrolyase
2-phospho-D-glycerate hydro-lyase
beta-enolase
EC 4.2.1
EC 4.2.1.11
enolase 3 (beta, muscle)
Enolase 3
enolase 3, (beta, muscle)
GSD13
MSE
Muscle-specific enolase
Skeletal muscle enolase
Background
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ENO3 Antibody (5D1) - Azide and BSA Free and receive a gift card or discount.