C1qTNF3/CORS26/CTRP3 Antibody


Immunocytochemistry/ Immunofluorescence: C1qTNF3/CORS26/CTRP3 Antibody [NBP2-57665] - Staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

C1qTNF3/CORS26/CTRP3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG
Specificity of human C1qTNF3/CORS26/CTRP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C1qTNF3/CORS26/CTRP3 Recombinant Protein Antigen (NBP2-57665PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for C1qTNF3/CORS26/CTRP3 Antibody

  • C1ATNF3
  • C1q and tumor necrosis factor related protein 3
  • C1qTNF3
  • Cartducin
  • cartonectin
  • collagenous repeat-containing sequence of 26-kDa
  • complement C1q tumor necrosis factor-related protein 3
  • complement-c1q tumor necrosis factor-related protein 3
  • Corcs
  • Cors
  • CORS26
  • Cors-26
  • CTRP3
  • CTRP32310005P21Rik
  • FLJ37576
  • Secretory protein CORS26


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665) (0)

There are no publications for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665) (0)

There are no reviews for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665)

Discover related pathways, diseases and genes to C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665)

Discover more about diseases related to C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665).

Pathways for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665)

View related products by pathway.

PTMs for C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665)

Learn more about PTMs related to C1qTNF3/CORS26/CTRP3 Antibody (NBP2-57665).

Blogs on C1qTNF3/CORS26/CTRP3

There are no specific blogs for C1qTNF3/CORS26/CTRP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C1qTNF3/CORS26/CTRP3 Antibody and receive a gift card or discount.


Gene Symbol C1QTNF3