c-Myb Antibody


Western Blot: c-Myb Antibody [NBP1-80306] - WB Suggested Anti-MYB Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.
Western Blot: c-Myb Antibody [NBP1-80306] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Product Details

Reactivity Hu, AvSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD

Order Details

c-Myb Antibody Summary

Synthetic peptide directed towards the N terminal of human MYB. Peptide sequence YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MYB and was validated on Western Blot and immunohistochemistry. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 31430446).
Control Peptide
c-Myb Protein (NBP1-80306PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-80306 in the following applications:

Read Publications using
NBP1-80306 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Avian reactivity reported in scientific literature (PMID: 31430446).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for c-Myb Antibody

  • c-myb protein (140 AA)
  • Cmyb
  • c-myb
  • c-myb_CDS
  • c-myb10A_CDS
  • c-myb13A_CDS
  • c-myb14A_CDS
  • c-myb8B_CDS
  • efg
  • Proto-oncogene c-Myb
  • transcriptional activator Myb
  • v-myb avian myeloblastosis viral oncogene homolog
  • v-myb myeloblastosis viral oncogene homolog (avian)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ChIP, IP, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA

Publications for c-Myb Antibody (NBP1-80306)(2)

We have publications tested in 2 confirmed species: Human, Avian.

We have publications tested in 3 applications: ICC/IF, IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for c-Myb Antibody (NBP1-80306) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-80306:
Filter by Applications
Western Blot
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot c-Myb NBP1-80306
reviewed by:
Costache Vasilescu
Western Blot Human 07/17/2014


ApplicationWestern Blot
Sample TestedWhole cell lysate from MOLT-4 cells, in lysis buffer

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for c-Myb Antibody (NBP1-80306). (Showing 1 - 1 of 1 FAQs).

  1. We recently ordered the anti c-myb antibody and I note that on the blot the MW of the band is 36kDa though c-myb should have a MW of 75 kDa. How was the specificity verified? Is the immunizing antigen available for performing a preabsorption negative control?
    • c-Myb has at least 12 known isoforms and one of these isoforms is around 37 kDa. There is a blocking peptide available for NBP1-80306. The catalog number will be NBP1-80306PEP

Secondary Antibodies


Isotype Controls

Additional c-Myb Products

Bioinformatics Tool for c-Myb Antibody (NBP1-80306)

Discover related pathways, diseases and genes to c-Myb Antibody (NBP1-80306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for c-Myb Antibody (NBP1-80306)

Discover more about diseases related to c-Myb Antibody (NBP1-80306).

Pathways for c-Myb Antibody (NBP1-80306)

View related products by pathway.

PTMs for c-Myb Antibody (NBP1-80306)

Learn more about PTMs related to c-Myb Antibody (NBP1-80306).

Research Areas for c-Myb Antibody (NBP1-80306)

Find related products by research area.

Blogs on c-Myb

There are no specific blogs for c-Myb, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Costache Vasilescu
Application: Western Blot
Species: Human


Gene Symbol MYB