c-Myb Antibody

Images

 
Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.
Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: c-Myb Antibody [NBP1-80306] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

c-Myb Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human MYB. Peptide sequence YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MYB and was validated on Western Blot and immunohistochemistry.
Control Peptide
c-Myb Protein (NBP1-80306PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-80306 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for c-Myb Antibody

  • c-myb protein (140 AA)
  • Cmyb
  • c-myb
  • c-myb_CDS
  • c-myb10A_CDS
  • c-myb13A_CDS
  • c-myb14A_CDS
  • c-myb8B_CDS
  • efg
  • Proto-oncogene c-Myb
  • transcriptional activator Myb
  • v-myb avian myeloblastosis viral oncogene homolog
  • v-myb myeloblastosis viral oncogene homolog (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-90171
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
MAB17791
Species: Hu, Mu
Applications: WB
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready

Publications for c-Myb Antibody (NBP1-80306) (0)

There are no publications for c-Myb Antibody (NBP1-80306).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for c-Myb Antibody (NBP1-80306) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-80306:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot c-Myb NBP1-80306
Enlarge
reviewed by:
Anonymous
WB Human 07/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedWhole cell lysate from MOLT-4 cells, in lysis buffer
SpeciesHuman

Blocking

Blocking Details5% milk in TBST buffer

Primary Anitbody

Dilution Ratio1:1000, diluted in TBST buffer+5% milk

Secondary Antibody

Secondary Descriptiongoat anti-rabbit IgG-HRP (SCBT)
Secondary Manufacturer Cat#2004
Secondary Concentration1:10000

Details

Detection NotesDetected using Santa Cruz Western Blotting Luminol Reagent, Exposure 10 sec

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for c-Myb Antibody (NBP1-80306). (Showing 1 - 1 of 1 FAQ).

  1. We recently ordered the anti c-myb antibody and I note that on the blot the MW of the band is 36kDa though c-myb should have a MW of 75 kDa. How was the specificity verified? Is the immunizing antigen available for performing a preabsorption negative control?
    • c-Myb has at least 12 known isoforms and one of these isoforms is around 37 kDa. There is a blocking peptide available for NBP1-80306. The catalog number will be NBP1-80306PEP

Secondary Antibodies

 

Isotype Controls

Additional c-Myb Products

Bioinformatics Tool for c-Myb Antibody (NBP1-80306)

Discover related pathways, diseases and genes to c-Myb Antibody (NBP1-80306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for c-Myb Antibody (NBP1-80306)

Discover more about diseases related to c-Myb Antibody (NBP1-80306).
 

Pathways for c-Myb Antibody (NBP1-80306)

View related products by pathway.

PTMs for c-Myb Antibody (NBP1-80306)

Learn more about PTMs related to c-Myb Antibody (NBP1-80306).

Blogs on c-Myb

There are no specific blogs for c-Myb, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
07/17/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol MYB
Uniprot