A-Myb Antibody - BSA Free

Staining of human Skeletal muscle shows no nuclear positivity in myocytes as expected.

Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts.

Staining of human Pancreas shows no nuclear positivity in exocrine glandular cells as expected.

Staining of human Liver shows no nuclear positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

A-Myb Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EANAVLSSLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKNTCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYBL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  A-Myb Protein (NBP1-90171PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%), Mouse (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for A-Myb Antibody - BSA Free

• A-MYB
• AMYBMGC120059
• MGC120061
• Myb-like protein 1
• myb-related protein A
• v-myb avian myeloblastosis viral oncogene homolog-like 1
• v-myb myeloblastosis viral oncogene homolog (avian)-like 1

Background

Strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for A-Myb Antibody (NBP1-90171)(4)

Publications using NBP1-90171

• Sakashita, A, Maezawa, S Et al. Endogenous retroviruses drive species-specific germline transcriptomes in mammals. Nat Struct Mol Biol 2020-10-01 [PMID: 32895553] (IHC-P, Mouse)
• Isbel L, Srivastava R, Oey H et al. Trim33 Binds and Silences a Class of Young Endogenous Retroviruses in the Mouse Testis; a Novel Component of the Arms Race between Retrotransposons and the Host Genome. PLoS Genet 2015-12-01 [PMID: 26624618] (WB, Mouse, Human)
• Qundos U, Hong MG, Tybring G et al. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. J Proteomics 2013-12-16 [PMID: 23631827]
• Tang H, Goldberg E. A-MYB (MYBL1) Stimulates Murine Testis-Specific Ldhc Expression via the cAMP-Responsive Element (CRE) Site. Biol Reprod 2012-02-01 [PMID: 21998171]

Bioinformatics

• Gene Symbol: MYBL1