c-Abl Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: c-Abl Antibody [NBP1-90289] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: c-Abl Antibody [NBP1-90289] - Staining of human adrenal gland shows strong nuclear positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

c-Abl Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
c-Abl Protein (NBP1-90289PEP)
Publications
Read Publication using
NBP1-90289 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25284075).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for c-Abl Antibody

  • Abelson murine leukemia viral oncogene homolog 1
  • ABL
  • ABL1
  • bcr/abl
  • BCR-ABL1
  • c-abl oncogene 1, non-receptor tyrosine kinase
  • c-abl oncogene 1, receptor tyrosine kinase
  • cAbl
  • c-Abl
  • EC 2.7.10
  • EC 2.7.10.2
  • JTK7
  • JTK7bcr/abl
  • p150bcr/c-abl oncogene protein
  • Proto-oncogene c-Abl
  • proto-oncogene tyrosine-protein kinase ABL1
  • tyrosine-protein kinase ABL1
  • v-abl Abelson murine leukemia viral oncogene homolog 1
  • v-abl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2988
Species: Mu, Rt
Applications: WB
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7548
Species: Hu
Applications: IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for c-Abl Antibody (NBP1-90289)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for c-Abl Antibody (NBP1-90289) (0)

There are no reviews for c-Abl Antibody (NBP1-90289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for c-Abl Antibody (NBP1-90289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional c-Abl Products

Bioinformatics Tool for c-Abl Antibody (NBP1-90289)

Discover related pathways, diseases and genes to c-Abl Antibody (NBP1-90289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for c-Abl Antibody (NBP1-90289)

Discover more about diseases related to c-Abl Antibody (NBP1-90289).
 

Pathways for c-Abl Antibody (NBP1-90289)

View related products by pathway.

PTMs for c-Abl Antibody (NBP1-90289)

Learn more about PTMs related to c-Abl Antibody (NBP1-90289).
 

Research Areas for c-Abl Antibody (NBP1-90289)

Find related products by research area.

Blogs on c-Abl

There are no specific blogs for c-Abl, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our c-Abl Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABL1
Entrez