BRIP1/FANCJ Antibody

Images

 
Western Blot: BRIP1/FANCJ Antibody [NBP2-14361] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: BRIP1/FANCJ Antibody [NBP2-14361] - Staining of human cell line A-431 shows positivity in nucleus and nuclear membrane.
Immunohistochemistry-Paraffin: BRIP1/FANCJ Antibody [NBP2-14361] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRIP1/FANCJ Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKME SKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHP LCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
BRIP1/FANCJ Protein (NBP2-14361PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRIP1/FANCJ Antibody

  • ATP-dependent RNA helicase BRIP1
  • BACH1
  • BACH1BRCA1/BRCA2-associated helicase 1
  • BRCA1 interacting protein C-terminal helicase 1
  • BRCA1-associated C-terminal helicase 1
  • BRCA1-binding helicase-like protein BACH1
  • BRCA1-interacting protein 1
  • BRCA1-interacting protein C-terminal helicase 1
  • BRIP1
  • EC 3.6.1
  • EC 3.6.4.13
  • FACJ
  • FANCJ
  • FANCJFanconi anemia group J protein
  • FLJ90232
  • MGC126521
  • MGC126523
  • OF
  • Protein FACJ

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
21340002
Species: Hu
Applications: ELISA
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-2564
Species: Hu
Applications: WB
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56552
Species: Hu
Applications: WB
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50418
Species: Hu
Applications: WB, ICC/IF, IP

Publications for BRIP1/FANCJ Antibody (NBP2-14361) (0)

There are no publications for BRIP1/FANCJ Antibody (NBP2-14361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRIP1/FANCJ Antibody (NBP2-14361) (0)

There are no reviews for BRIP1/FANCJ Antibody (NBP2-14361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BRIP1/FANCJ Antibody (NBP2-14361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRIP1/FANCJ Products

Bioinformatics Tool for BRIP1/FANCJ Antibody (NBP2-14361)

Discover related pathways, diseases and genes to BRIP1/FANCJ Antibody (NBP2-14361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRIP1/FANCJ Antibody (NBP2-14361)

Discover more about diseases related to BRIP1/FANCJ Antibody (NBP2-14361).
 

Pathways for BRIP1/FANCJ Antibody (NBP2-14361)

View related products by pathway.

PTMs for BRIP1/FANCJ Antibody (NBP2-14361)

Learn more about PTMs related to BRIP1/FANCJ Antibody (NBP2-14361).
 

Research Areas for BRIP1/FANCJ Antibody (NBP2-14361)

Find related products by research area.

Blogs on BRIP1/FANCJ

There are no specific blogs for BRIP1/FANCJ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRIP1/FANCJ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRIP1
Entrez