Orthogonal Strategies: Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining in human placenta and pancreas tissues using anti-BNIP3L antibody. Corresponding BNIP3L RNA-seq data are presented for ...read more
Orthogonal Strategies: Western Blot: BNIP3L Antibody [NBP1-88558] - UCB-hMSCs were exposed to normoxia or hypoxia. (D) The mRNA expressions of PINK1, BNIP3, NIX and FUNDC1 were analyzed by quantitative real-time ...read more
Biological Strategies: Western Blot: BNIP3L Antibody [NBP1-88558] - Vehicle or RU 486 (5 mg/kg) injected mice were presented with/without corticosterone (10 mg/kg) for 3 days. The expressions of peroxisome ...read more
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human placenta shows high expression.
Corticosterone affects NIX-dependent mitophagy through decreasing PGC1 alpha in vivo.a–f Mice exposed to vehicle, corticosterone (10 mg/kg), corticosterone with phorbol 12-myristate 13-acetate (PMA pretreatment, ...read more
Western Blot: BNIP3L Antibody [NBP1-88558] - Role of PGC1 alpha in NIX-dependent mitophagy.a–e Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to corticosterone & ...read more
Western Blot: BNIP3L Antibody [NBP1-88558] - GR-dependent downregulation of NIX expression via PGC1 alpha .a, b Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to ...read more
Western Blot: BNIP3L Antibody [NBP1-88558] - GR-dependent downregulation of NIX expression via PGC1 alpha .a, b Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to ...read more
Western Blot: BNIP3L Antibody [NBP1-88558] - Effects of hypoxia on mitophagy regulator expressions & mitophagy in UCB-hMSCs. (A) UCB-hMSCs incubated w/ various times of hypoxia (0–48 h). Cells stained w/ ...read more
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC ...read more
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC ...read more
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC ...read more
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC ...read more
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNIP3L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in the scientific literature (PMID: 24573672).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for BNIP3L Antibody - BSA Free
Adenovirus E1B19K-binding protein B5
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
BCL2/adenovirus E1B 19-kd protein-interacting protein 3a
BCL2/adenovirus E1B 19kDa interacting protein 3-like
BNIP3a
BNIP3H
BNIP3L
Nip3L
NIP3-like protein X
Nix
NIXBCL2/adenovirus E1B 19kD-interacting protein 3-like
Background
Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, Hrk, Nip3, and Bim, form a growingsubclass of the Bcl-2 family. A novel BH3 domaincontaining protein was recently identified and designated Bnip3L, Bnip3a, and Nix (for Nip3-like protein X) (Matsushima, M. et al.; Yasuda, M. et al.; Chen, G, et al.).Bnip3L/Bnip3a/Nix is a homolog of the E1B 19K/Bcl-2 binding and pro-apoptotic protein Bnip3. Over expression of Bnip3L induces apoptosis (Yasuda, M. et al.; Chen, G, et al.). Bnip3L interacts withand overcomes suppresses by Bcl-2 and Bcl-xL. Bnip3Lis localized in mitochondria. The messenger RNA of Bnip3L is ubiquitously expressed in human tissues (Matsushima, M. et al.; Yasuda, M. et al.). Bnip3L and Bnip3 form a new subfamily of the pro-apoptotic mitochondrial proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our BNIP3L Antibody - BSA Free and receive a gift card or discount.