BNIP3 Antibody - BSA Free

Western Blot: BNIP3 Antibody [NBP1-82566] - Analysis in human cell line U-87 MG.

Immunohistochemistry-Paraffin: BNIP3 Antibody [NBP1-82566] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: BNIP3 Antibody [NBP1-82566] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: BNIP3 Antibody [NBP1-82566] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: BNIP3 Antibody [NBP1-82566] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BNIP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BNIP3 Antibody - BSA Free (NBP1-82566) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BNIP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BNIP3 Protein (NBP1-82566PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BNIP3 Antibody - BSA Free

• BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
• BCL2/adenovirus E1B 19kDa interacting protein 3
• BCL2/adenovirus E1B 19kD-interacting protein 3
• BNIP3
• Nip3

Background

BCL2/adenovirus E1B 19kD protein-interacting protein 3 (BNIP3) is a mitochondrial protein critical for apoptotic events in response to adenovirus infection. It has been implicated in causing a necrotic-like cell death pattern in cells, induced by CD47. This effect has been seen in many cancer cells, and its mis-regulation causes tumor cells to be impervious to normal autophagic events. The tumor suppressor p53 represses the expression of BNIP3, often as a consequence of hypoxic micro-environments as seen in tumors. When BNIP3 is correctly expressed and activated, it translocates to the mitochondria and instigates apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BNIP3