BMP-4 Antibody (7Q2U7)

Western Blot: BMP-4 Antibody (7Q2U7) [NBP3-15376] - Analysis of extracts of various cell lines, using BMP-4 Rabbit mAb (NBP3-15376) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: BMP-4 Antibody (7Q2U7) [NBP3-15376] - Immunofluorescence analysis of HeLa cells using BMP-4 Rabbit mAb (NBP3-15376) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: BMP-4 Antibody (7Q2U7) [NBP3-15376] - Human colon using BMP-4 Rabbit mAb (NBP3-15376) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: BMP-4 Antibody (7Q2U7) [BMP-4] - Confocal imaging of HeLa cells using BMP-4 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clone: 7Q2U7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

BMP-4 Antibody (7Q2U7) Summary

• Description: Novus Biologicals Rabbit BMP-4 Antibody (7Q2U7) (NBP3-15376) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 309-408 of human BMP-4 (P12644). RRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BMP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BMP-4 Antibody (7Q2U7)

• BMP2B
• BMP-2B
• BMP2B1
• BMP2BMCOPS6
• BMP4
• BMP-4
• Bone morphogenetic protein 2B
• bone morphogenetic protein 4
• DVR4
• MCOPS6
• OFC11
• ZYME

Background

Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Through molecular cloning, 7 BMP cDNAs, designated BMP1 through BMP7, have been recovered. BMP2 through BMP7, are members of the transforming growth factor-beta superfamily of regulatory molecules. Transcript variants utilizing alternative promoters and alternative non-coding first exons have been described in the literature.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BMP4