BMP-3b/GDF-10 Antibody

Images

 
Immunohistochemistry: BMP-3b/GDF-10 Antibody [NBP1-88574] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

BMP-3b/GDF-10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDF10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
BMP-3b/GDF-10 Protein (NBP1-88574PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Alternate Names for BMP-3b/GDF-10 Antibody

  • BIP
  • BMP3b
  • BMP-3b
  • bone morphogenetic protein 3B
  • Bone-inducing protein
  • GDF10
  • GDF-10
  • growth differentiation factor 10
  • Growth/differentiation factor 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-78403
Species: Hu, Rt
Applications: WB, ChIP, IHC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00005034-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1852
Species: Hu
Applications: WB, IHC, IHC-P
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00000468-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-76801
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for BMP-3b/GDF-10 Antibody (NBP1-88574) (0)

There are no publications for BMP-3b/GDF-10 Antibody (NBP1-88574).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-3b/GDF-10 Antibody (NBP1-88574) (0)

There are no reviews for BMP-3b/GDF-10 Antibody (NBP1-88574). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BMP-3b/GDF-10 Antibody (NBP1-88574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMP-3b/GDF-10 Antibody Products

Related Products by Gene

Bioinformatics Tool for BMP-3b/GDF-10 Antibody (NBP1-88574)

Discover related pathways, diseases and genes to BMP-3b/GDF-10 Antibody (NBP1-88574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-3b/GDF-10 Antibody (NBP1-88574)

Discover more about diseases related to BMP-3b/GDF-10 Antibody (NBP1-88574).
 

Pathways for BMP-3b/GDF-10 Antibody (NBP1-88574)

View related products by pathway.

PTMs for BMP-3b/GDF-10 Antibody (NBP1-88574)

Learn more about PTMs related to BMP-3b/GDF-10 Antibody (NBP1-88574).
 

Research Areas for BMP-3b/GDF-10 Antibody (NBP1-88574)

Find related products by research area.

Blogs on BMP-3b/GDF-10

There are no specific blogs for BMP-3b/GDF-10, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GDF10
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-88574 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought