BMP-3b/GDF-10 Antibody (NBP1-88574)

Images

 
Immunohistochemistry: BMP-3b/GDF-10 Antibody [NBP1-88574] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BMP-3b/GDF-10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDF10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
BMP-3b/GDF-10 Protein (NBP1-88574PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BMP-3b/GDF-10 Antibody

  • BIP
  • BMP3b
  • BMP-3b
  • bone morphogenetic protein 3B
  • Bone-inducing protein
  • GDF10
  • GDF-10
  • growth differentiation factor 10
  • Growth/differentiation factor 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76801
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88574
Species: Hu
Applications: IHC, IHC-P

Publications for BMP-3b/GDF-10 Antibody (NBP1-88574) (0)

There are no publications for BMP-3b/GDF-10 Antibody (NBP1-88574).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-3b/GDF-10 Antibody (NBP1-88574) (0)

There are no reviews for BMP-3b/GDF-10 Antibody (NBP1-88574). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BMP-3b/GDF-10 Antibody (NBP1-88574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMP-3b/GDF-10 Antibody Products

Related Products by Gene

Bioinformatics Tool for BMP-3b/GDF-10 Antibody (NBP1-88574)

Discover related pathways, diseases and genes to BMP-3b/GDF-10 Antibody (NBP1-88574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-3b/GDF-10 Antibody (NBP1-88574)

Discover more about diseases related to BMP-3b/GDF-10 Antibody (NBP1-88574).
 

Pathways for BMP-3b/GDF-10 Antibody (NBP1-88574)

View related products by pathway.

PTMs for BMP-3b/GDF-10 Antibody (NBP1-88574)

Learn more about PTMs related to BMP-3b/GDF-10 Antibody (NBP1-88574).
 

Research Areas for BMP-3b/GDF-10 Antibody (NBP1-88574)

Find related products by research area.

Blogs on BMP-3b/GDF-10

There are no specific blogs for BMP-3b/GDF-10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMP-3b/GDF-10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF10
Entrez

Customers Who Bought This Also Bought