Biliverdin Reductase B/BLVRB Antibody


Western Blot: Biliverdin Reductase B/BLVRB Antibody [NBP1-83434] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma more
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83434] - Staining of human spleen shows strong cytoplasmic positivity in subsets of cells in red and white pulp.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Biliverdin Reductase B/BLVRB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDH
Specificity of human Biliverdin Reductase B/BLVRB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Biliverdin Reductase B/BLVRB Lysate (NBP2-65593)
Control Peptide
Biliverdin Reductase B/BLVRB Protein (NBP1-83434PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Biliverdin Reductase B/BLVRB Antibody

  • biliverdin reductase B (flavin reductase (NADPH))
  • Biliverdin Reductase B
  • Biliverdin-IX beta-reductase
  • BVRB
  • BVR-B
  • EC
  • EC
  • flavin reductase (NADPH)
  • flavin reductase
  • FLR
  • FR
  • GHBP
  • Green heme-binding protein
  • MGC117413
  • NADPH-dependent diaphorase
  • NADPH-flavin reductase
  • SDR43U1
  • short chain dehydrogenase/reductase family 43U, member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434) (0)

There are no publications for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434) (0)

There are no reviews for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Biliverdin Reductase B/BLVRB Products

Bioinformatics Tool for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434)

Discover related pathways, diseases and genes to Biliverdin Reductase B/BLVRB Antibody (NBP1-83434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434)

Discover more about diseases related to Biliverdin Reductase B/BLVRB Antibody (NBP1-83434).

Pathways for Biliverdin Reductase B/BLVRB Antibody (NBP1-83434)

View related products by pathway.

Blogs on Biliverdin Reductase B/BLVRB

There are no specific blogs for Biliverdin Reductase B/BLVRB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Biliverdin Reductase B/BLVRB Antibody and receive a gift card or discount.


Gene Symbol BLVRB