Recombinant Human BIK Protein

Images

 
SDS-Page: Recombinant Human BIK Protein [H00000638-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BIK Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human BIK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BIK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BIK Protein

  • Apoptosis inducer NBK
  • BCL2-interacting killer (apoptosis-inducing)
  • bcl-2-interacting killer
  • BIK
  • BIP1
  • BP4
  • NBK
  • NBKapoptosis-inducing NBK

Background

BIK - BCL2-interacting killer (apoptosis-inducing)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF851
Species: Hu
Applications: WB
H00000638-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for BIK Partial Recombinant Protein (H00000638-Q01) (0)

There are no publications for BIK Partial Recombinant Protein (H00000638-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIK Partial Recombinant Protein (H00000638-Q01) (0)

There are no reviews for BIK Partial Recombinant Protein (H00000638-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BIK Partial Recombinant Protein (H00000638-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BIK Products

Bioinformatics Tool for BIK Partial Recombinant Protein (H00000638-Q01)

Discover related pathways, diseases and genes to BIK Partial Recombinant Protein (H00000638-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIK Partial Recombinant Protein (H00000638-Q01)

Discover more about diseases related to BIK Partial Recombinant Protein (H00000638-Q01).
 

Pathways for BIK Partial Recombinant Protein (H00000638-Q01)

View related products by pathway.

PTMs for BIK Partial Recombinant Protein (H00000638-Q01)

Learn more about PTMs related to BIK Partial Recombinant Protein (H00000638-Q01).
 

Research Areas for BIK Partial Recombinant Protein (H00000638-Q01)

Find related products by research area.

Blogs on BIK

There are no specific blogs for BIK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BIK Antibody
NB100-56109

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BIK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BIK
Entrez