Recombinant Human Beta Hydroxysteroid Dehydrogenase Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Beta Hydroxysteroid Dehydrogenase Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 372 of Human HSD3B2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HSD3B2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Beta Hydroxysteroid Dehydrogenase Protein

  • 3 beta-HSD type II
  • 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
  • 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II
  • 3-beta-HSD II
  • delta 5-delta 4-isomerase type II
  • HSD3B
  • HSDB
  • HSDB3B
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2,3-beta-hydroxy-Delta(5)-steroid dehydrogenase
  • progesterone reductase
  • SDR11E2
  • short chain dehydrogenase/reductase family 11E, member 2,3-beta-hydroxy-5-ene steroid dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-56518
Species: Hu
Applications: WB
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB7450
Species: Hu
Applications: IHC
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00003284-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01) (0)

There are no publications for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01) (0)

There are no reviews for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Beta Hydroxysteroid Dehydrogenase Products

Bioinformatics Tool for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01)

Discover related pathways, diseases and genes to Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01)

Discover more about diseases related to Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01).
 

Pathways for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01)

View related products by pathway.

PTMs for Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01)

Learn more about PTMs related to Beta Hydroxysteroid Dehydrogenase Recombinant Protein (H00003284-P01).

Blogs on Beta Hydroxysteroid Dehydrogenase

There are no specific blogs for Beta Hydroxysteroid Dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Beta Hydroxysteroid Dehydrogenase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD3B2