beta-Catenin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody [NBP1-89990] - Staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89990] - Staining in human placenta and skeletal muscle tissues using anti-CTNNB1 antibody. Corresponding CTNNB1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89990] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89990] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89990] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta-Catenin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPD
Marker
Epithelial Cell Marker, Adherens Junction Marker
Specificity
Specificity of human beta-Catenin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTNNB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
beta-Catenin Protein (NBP1-89990PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta-Catenin Antibody

  • bCatenin
  • beta 1 (88kD)
  • beta-Catenin
  • catenin (cadherin-associated protein), beta 1, 88kDa
  • catenin beta-1
  • CTNNB
  • CTNNB1
  • DKFZp686D02253
  • FLJ25606
  • FLJ37923

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-66858
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89990
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for beta-Catenin Antibody (NBP1-89990) (0)

There are no publications for beta-Catenin Antibody (NBP1-89990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Catenin Antibody (NBP1-89990) (0)

There are no reviews for beta-Catenin Antibody (NBP1-89990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for beta-Catenin Antibody (NBP1-89990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-Catenin Products

Bioinformatics Tool for beta-Catenin Antibody (NBP1-89990)

Discover related pathways, diseases and genes to beta-Catenin Antibody (NBP1-89990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Catenin Antibody (NBP1-89990)

Discover more about diseases related to beta-Catenin Antibody (NBP1-89990).
 

Pathways for beta-Catenin Antibody (NBP1-89990)

View related products by pathway.

PTMs for beta-Catenin Antibody (NBP1-89990)

Learn more about PTMs related to beta-Catenin Antibody (NBP1-89990).
 

Research Areas for beta-Catenin Antibody (NBP1-89990)

Find related products by research area.

Blogs on beta-Catenin.

Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma
By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Notch1 - A multifunctional transmembrane receptor
Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Catenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNNB1
Entrez