beta-Catenin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody [NBP1-89989] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining in human cervix, uterine and skeletal muscle tissues . Corresponding CTNNB1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human cervix, uterine shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human skeletal muscle shows weak positivity in myocytes.

Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human prostate shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human duodenum shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: beta-Catenin Antibody [NBP1-89989] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.

Analysis in human cell line SW480.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

beta-Catenin-Antibody-Western-Blot-NBP1-89989-img0026.jpg

• Reactivity: Hu, Mu, Rt, Fi
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

beta-Catenin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit beta-Catenin Antibody - BSA Free (NBP1-89989) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-beta-Catenin Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
• Marker: Epithelial Cell Marker, Adherens Junction Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTNNB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  beta-Catenin Protein (NBP1-89989PEP)

Reactivity Notes

Fish reactivity reported in scientific literature (PMID: 25502575).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for beta-Catenin Antibody - BSA Free

• bCatenin
• beta 1 (88kD)
• beta-Catenin
• catenin (cadherin-associated protein), beta 1, 88kDa
• catenin beta-1
• CTNNB
• CTNNB1
• DKFZp686D02253
• FLJ25606
• FLJ37923

Background

The protein encoded by the beta Catenin gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs arenecessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion betweencells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contactinhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this proteinbinds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this geneare a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for beta-Catenin Antibody (NBP1-89989)(3)

Publications using NBP1-89989

• Milara J, Peiro T, Serrano A et al. Simvastatin Increases the Ability of Roflumilast N-oxide to Inhibit Cigarette Smoke-Induced Epithelial to Mesenchymal Transition in Well-differentiated Human Bronchial Epithelial Cells in vitro. COPD. 2014-09-10 [PMID: 25207459]
• Pomares, A Tumorspheres as an in vitro model for cancer stem-like cell characterization in non-small cell lung cancer. Prognostic implications. Thesis 2020-01-01 (WB)
• Pastor-Clerigues Alfonso, Marti-Bonmati Ezequiel, Milara Javier et al. Anti-inflammatory and anti-fibrotic profile of fish oil emulsions used in parenteral nutrition-associated liver disease. PLoS One. 2014-12-12 [PMID: 25502575] (Fish)

Bioinformatics

• Gene Symbol: CTNNB1
• Entrez:
  • 1499(Human)
• Uniprot:
  • P35222()