beta-1 Adrenergic R/ADRB1 Antibody

Images

 
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Positive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20ug ...read more
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Heart Antibody Dilution: 1.0ug/ml.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Lung Antibody Dilution: 1.0ug/m.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Muscle Antibody Dilution: 1.0ug/ml
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Adult Placenta Antibody Dilution: 1.0ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta-1 Adrenergic R/ADRB1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (100%), Rabbit (93%), Guinea Pig (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADRB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ADRB1 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
Human Brain Corpus Callosum Whole Tissue Lysate (Adult Whole Multiple Sclerosis)
beta-1 Adrenergic R/ADRB1 Knockout HeLa Cell Lysate
Publications
Read Publications using
NBP1-59007 in the following applications:

  • WB
    2 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 30660767).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for beta-1 Adrenergic R/ADRB1 Antibody

  • ADRB1
  • ADRB1R
  • ADRB1RRHR
  • adrenergic, beta-1-, receptor
  • B1AR
  • beta-1 Adrenergic R
  • beta-1 adrenergic receptor
  • beta1 AdrenergicR
  • beta-1 AdrenergicR
  • Beta-1 adrenoceptor
  • Beta-1 adrenoreceptor
  • BETA1AR

Background

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61710
Species: Hu, Rt
Applications: WB, ELISA, Flow
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NLS4198
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-93554
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-92862
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-61144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52107
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59007
Species: Hu, Mu, Rt, Po, Gp, Rb
Applications: WB

Publications for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007) (0)

There are no reviews for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional beta-1 Adrenergic R/ADRB1 Products

Bioinformatics Tool for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)

Discover related pathways, diseases and genes to beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)

Discover more about diseases related to beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007).
 

Pathways for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)

View related products by pathway.

PTMs for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)

Learn more about PTMs related to beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007).
 

Research Areas for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)

Find related products by research area.

Blogs on beta-1 Adrenergic R/ADRB1

There are no specific blogs for beta-1 Adrenergic R/ADRB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-1 Adrenergic R/ADRB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADRB1
Uniprot