We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

Images

 
Biological Strategies: Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Positive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug ...read more
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Heart Antibody Dilution: 1.0ug/ml.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Lung Antibody Dilution: 1.0ug/m.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Muscle Antibody Dilution: 1.0ug/ml
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Adult Placenta Antibody Dilution: 1.0ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml
Validated by:
   

Biological Strategies

     

Order Details

beta-1 Adrenergic R/ADRB1 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADRB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
Human Brain Corpus Callosum Whole Tissue Lysate (Adult Whole Multiple Sclerosis)
Publications
Read Publications using
NBP1-59007 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 30660767).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

  • ADRB1
  • ADRB1R
  • ADRB1RRHR
  • adrenergic, beta-1-, receptor
  • B1AR
  • beta-1 Adrenergic R
  • beta-1 adrenergic receptor
  • beta1 AdrenergicR
  • beta-1 AdrenergicR
  • Beta-1 adrenoceptor
  • Beta-1 adrenoreceptor
  • BETA1AR

Background

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67187
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NLS4198
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
262-AR
Species: Hu
Applications: BA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF2699
Species: Mu
Applications: Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-22397
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-13891
Species: Hu
Applications: IHC,  IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-52107
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-85569
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88027
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP1-59007
Species: Hu, Rt
Applications: WB

Publications for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)(6)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: WB, Western Blot.


Filter By Application
WB
(2)
Western Blot
(4)
All Applications
Filter By Species
Human
(5)
Rat
(1)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-59007 Applications Species
Alhamyani A, Napit PR, Bheemanapally K et al. Singular versus combinatory glucose-sensitive signal control of metabolic sensor protein profiles in hypothalamic astrocyte cultures from each sex Translational Neuroscience 2022-11-30 [PMID: 36518559] (Western Blot, Human) Western Blot Human
Alhamyani A, Napit PR, Ali H et al. Ventrolateral ventromedial hypothalamic nucleus GABA neuron adaptation to recurring Hypoglycemia correlates with up-regulated 5'-AMP-activated protein kinase activity AIMS Neuroscience 2021-09-03 [PMID: 34877402] (Western Blot, Human) Western Blot Human
Alhamyani A, Mahmood ASMH, Alshamrani A et al. Central Type II Glucocorticoid Receptor Regulation of Ventromedial Hypothalamic Nucleus Glycogen Metabolic Enzyme and Glucoregulatory Neurotransmitter Marker Protein Expression in the Male Rat J Endocrinol Diabetes 2021-01-13 [PMID: 34258390] (Western Blot, Human) Western Blot Human
Ibrahim MMH, Bheemanapally K, Sylvester PW, Briski KP. Norepinephrine Regulation of Adrenergic Receptor Expression, 5' AMP-Activated Protein Kinase Activity, and Glycogen Metabolism and Mass in Male Versus Female Hypothalamic Primary Astrocyte Cultures ASN Neuro 2020-11-12 [PMID: 33176438] (Western Blot, Human) Western Blot Human
Hasan Mahmood ASM, Mandal SK, Bheemanapally K et al. Norepinephrine control of ventromedial hypothalamic nucleus glucoregulatory neurotransmitter expression in the female rat: Role of monocarboxylate transporter function. Mol. Cell. Neurosci. 2019-01-17 [PMID: 30660767] (WB, Rat) WB Rat
Ma X, Zhao T, Ouyang T et al. Propranolol enhanced adipogenesis instead of induction of apoptosis of hemangiomas stem cells. Int J Clin Exp Pathol. 2014-08-14 [PMID: 25120757] (WB, Human) WB Human

Reviews for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007) (0)

There are no reviews for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional beta-1 Adrenergic R/ADRB1 Products

Research Areas for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007)

Find related products by research area.

Blogs on beta-1 Adrenergic R/ADRB1

There are no specific blogs for beta-1 Adrenergic R/ADRB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-1 Adrenergic R/ADRB1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ADRB1
Uniprot