CYLN2 Antibody

Images

 
Orthogonal Strategies: Western Blot: CYLN2 Antibody [NBP1-85569] - Analysis in human cell lines SK-MEL-30 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CYLN2 Antibody [NBP1-85569] - Staining in human cerebral cortex and kidney tissues using anti-CLIP2 antibody. Corresponding CLIP2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: CYLN2 Antibody [NBP1-85569] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CYLN2 Antibody [NBP1-85569] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CYLN2 Antibody [NBP1-85569] - Staining of human kidney shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CYLN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA
Specificity
Specificity of human CYLN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYLN2 Protein (NBP1-85569PEP)
Publications
Read Publication using
NBP1-85569 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25284583).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYLN2 Antibody

  • CAP-GLY domain containing linker protein 2
  • CAP-Gly domain-containing linker protein 2
  • CLIP
  • CLIP-115Williams-Beuren syndrome chromosomal region 3 protein
  • CYLN2WBSCR3
  • cytoplasmic linker 2
  • Cytoplasmic linker protein 115
  • KIAA0291Williams-Beuren syndrome chromosomal region 4 protein
  • WBSCR4MGC11333
  • Williams-Beuren syndrome chromosome region 3
  • Williams-Beuren syndrome chromosome region 4
  • WSCR3
  • WSCR4Cytoplasmic linker protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-45552
Species: Hu
Applications: WB, IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu

Publications for CYLN2 Antibody (NBP1-85569)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CYLN2 Antibody (NBP1-85569) (0)

There are no reviews for CYLN2 Antibody (NBP1-85569). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYLN2 Antibody (NBP1-85569) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CYLN2 Antibody (NBP1-85569)

Discover related pathways, diseases and genes to CYLN2 Antibody (NBP1-85569). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYLN2 Antibody (NBP1-85569)

Discover more about diseases related to CYLN2 Antibody (NBP1-85569).
 

Pathways for CYLN2 Antibody (NBP1-85569)

View related products by pathway.

PTMs for CYLN2 Antibody (NBP1-85569)

Learn more about PTMs related to CYLN2 Antibody (NBP1-85569).

Blogs on CYLN2

There are no specific blogs for CYLN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYLN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIP2