CLIP170 Antibody - BSA Free

Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in human cell line HDLM-2 and human cell line U-2197.

Immunocytochemistry/Immunofluorescence: CLIP170 Antibody [NBP1-85568] - Staining of human cell line SiHa shows localization to microtubule ends. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myoctes.

Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human liver shows negative positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLIP170 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLIP170 Antibody - BSA Free (NBP1-85568) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CLIP170 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLIP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CLIP170 Protein (NBP1-85568PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CLIP170 Antibody - BSA Free

• CAP-GLY domain containing linker protein 1
• CLIP
• CLIP170
• CLIP-170Reed-Sternberg intermediate filament-associated protein
• CYLN1MGC131604
• cytoplasmic linker 1
• Cytoplasmic linker protein 1
• Cytoplasmic linker protein 170 alpha-2
• Reed-Steinberg cell-expressed intermediate filament-associated protein
• restin (Reed-Steinberg cell-expressed intermediate filament-associated protein)
• Restin
• RSNCAP-Gly domain-containing linker protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLIP170 Antibody (NBP1-85568)(1)

Publication using NBP1-85568

• Hotta T, McAlear TS, Yue Y et al. EML2-S constitutes a new class of proteins that recognizes and regulates the dynamics of tyrosinated microtubules Current biology : CB 2022-08-06 [PMID: 35963242]

Bioinformatics

• Gene Symbol: CLIP1