![Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in human cell line HDLM-2 and human cell line U-2197.](http://images.novusbio.com/fullsize2/CLIP170-Antibody-Western-Blot-NBP1-85568-img0012.jpg "Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in human cell line HDLM-2 and human cell line U-2197.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLIP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
-Flow-Cytometry-NBP2-00714-img0001.jpg)
-Flow-Cytometry-NBP2-00714-img0002.jpg)
-Flow-Cytometry-NBP2-00714-img0003.jpg)
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
| Publication using NBP1-85568 | Applications | Species |
|---|---|---|
| Hotta T, McAlear TS, Yue Y et al. EML2-S constitutes a new class of proteins that recognizes and regulates the dynamics of tyrosinated microtubules Current biology : CB 2022-08-06 [PMID: 35963242] |
Secondary Antibodies |
Isotype Controls |
Diseases for CLIP170 Antibody (NBP1-85568)Discover more about diseases related to CLIP170 Antibody (NBP1-85568).
| Pathways for CLIP170 Antibody (NBP1-85568)View related products by pathway.
|
PTMs for CLIP170 Antibody (NBP1-85568)Learn more about PTMs related to CLIP170 Antibody (NBP1-85568).
| Research Areas for CLIP170 Antibody (NBP1-85568)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLIP1 |
![Immunocytochemistry/Immunofluorescence: CLIP170 Antibody [NBP1-85568] - Staining of human cell line SiHa shows localization to microtubule ends. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/CLIP170-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85568-img0011.jpg "Immunocytochemistry/Immunofluorescence: CLIP170 Antibody [NBP1-85568] - Staining of human cell line SiHa shows localization to microtubule ends. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myoctes.](http://images.novusbio.com/fullsize2/CLIP170-Antibody-Immunohistochemistry-Paraffin-NBP1-85568-img0015.jpg "Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myoctes.")
![Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/CLIP170-Antibody-Western-Blot-NBP1-85568-img0008.jpg "Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/CLIP170-Antibody-Immunohistochemistry-Paraffin-NBP1-85568-img0002.jpg "Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize2/CLIP170-Antibody-Immunohistochemistry-Paraffin-NBP1-85568-img0013.jpg "Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human liver shows negative positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/CLIP170-Antibody-Immunohistochemistry-Paraffin-NBP1-85568-img0014.jpg "Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human liver shows negative positivity in hepatocytes as expected.")
)-Western-Blot-NB100-62346-img0002.jpg)
)-Immunohistochemistry-NB100-62346-img0003.jpg)
)-Western-Blot-NB100-62346-img0001.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
-Knockdown-Validated-H00008826-M01-img0011.jpg)
-Western-Blot-H00008826-M01-img0012.jpg)
-Immunocytochemistry-Immunofluorescence-H00008826-M01-img0006.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Western_Blot_5321.jpg)
![Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Simple_Western_16637.jpg)
![Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Immunocytochemistry__Immunofluorescence_17390.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")