CLIP170 Antibody

Images

 
Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CLIP170 Antibody [NBP1-85568] - Immunofluorescent staining of human cell line SiHa shows localization to microtubule ends.
Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: CLIP170 Antibody [NBP1-85568] - Analysis in human cell line SiHa.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLIP170 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLIP170 Protein (NBP1-85568PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLIP170 Antibody

  • CAP-GLY domain containing linker protein 1
  • CLIP
  • CLIP170
  • CLIP-170Reed-Sternberg intermediate filament-associated protein
  • CYLN1MGC131604
  • cytoplasmic linker 1
  • Cytoplasmic linker protein 1
  • Cytoplasmic linker protein 170 alpha-2
  • Reed-Steinberg cell-expressed intermediate filament-associated protein
  • restin (Reed-Steinberg cell-expressed intermediate filament-associated protein)
  • Restin
  • RSNCAP-Gly domain-containing linker protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00056899-P01
Species: Hu
H00009167-B02P
Species: Hu
Applications: WB, ELISA
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC

Publications for CLIP170 Antibody (NBP1-85568) (0)

There are no publications for CLIP170 Antibody (NBP1-85568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIP170 Antibody (NBP1-85568) (0)

There are no reviews for CLIP170 Antibody (NBP1-85568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLIP170 Antibody (NBP1-85568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLIP170 Products

Bioinformatics Tool for CLIP170 Antibody (NBP1-85568)

Discover related pathways, diseases and genes to CLIP170 Antibody (NBP1-85568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIP170 Antibody (NBP1-85568)

Discover more about diseases related to CLIP170 Antibody (NBP1-85568).
 

Pathways for CLIP170 Antibody (NBP1-85568)

View related products by pathway.

PTMs for CLIP170 Antibody (NBP1-85568)

Learn more about PTMs related to CLIP170 Antibody (NBP1-85568).
 

Research Areas for CLIP170 Antibody (NBP1-85568)

Find related products by research area.

Blogs on CLIP170

There are no specific blogs for CLIP170, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIP170 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIP1