Home » BCS1L » BCS1L Antibodies » BCS1L Antibody

BCS1L Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human skin shows moderate positivity in cytoplasm in squamous epithelial cells.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human skin shows moderate positivity in cytoplasm in squamous epithelial cells.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human parathyroid gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining in human parathyroid gland and pancreas tissues using anti-BCS1L antibody. Corresponding BCS1L RNA-seq data are ...read more
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human Fallopian tube shows moderate positivity in cytoplasm in glandular cells.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

BCS1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAES
Specificity
Specificity of human BCS1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCS1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BCS1L Protein (NBP1-88678PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCS1L Antibody

  • BCS
  • BCS1 (yeast homolog)-like
  • BCS1
  • BCS1-like (S. cerevisiae)
  • BCS1-like (yeast)
  • BCS1-like protein
  • BJSGRACILE
  • FLNMS
  • h-BCS
  • h-BCS1
  • mitochondrial chaperone BCS1
  • mitochondrial complex III assembly
  • PTD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(5 Reviews)
(141 Publications)
Species: Hu

Nesfatin-1/Nucleobindi
NBP1-87383
Western Blot: Nesfatin-1/Nucleobindin-2 Antibody [NBP1-87383] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Nesfatin-1/Nucleobindin-2 Antibody [NBP1-87383] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Nesfatin-1/Nucleobindin-2 Antibody [NBP1-87383] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
DMPK Antibody
(713931)
MAB6967
Western blot shows lysates of human heart tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human DMPK Monoclonal Antibody (Catalog # MAB6967) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for DMPK at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Leptin/OB [HRP]
DLP00
(4 Reviews)
(100 Publications)
Species: Hu
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(39 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Recombinant Human
POMT1 GST (N-Term) Pr ...
H00010585-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Human
Ceruloplasmin ELISA K ...
NBP2-60616
ELISA: Human Ceruloplasmin ELISA Kit (Colorimetric) [NBP2-60616]
Species: Hu
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(9 Reviews)
(42 Publications)
Species: Hu
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Progesterone
R/NR3C3 Antibody (4E9
H00005241-M08
Western Blot: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of PGR expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/Immunofluorescence: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on MCF-7 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
(2 Publications)
Species: Hu, Mu
Applications: WB
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Recombinant Human
gamma-glutamyl hydrol ...
NBP1-78898
SDS-Page: Recombinant Human gamma-glutamyl hydrolase Protein [NBP1-78898]
(3 Publications)
Species: Hu
MMP-12 Antibody
NBP1-31225
Western Blot: MMP-12 Antibody [NBP1-31225] - Sample(30 ug whole cell lysate) A:293T 10% SDS PAGE, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: MMP-12 Antibody [NBP1-31225] - Analysis of methanol-fixed H1299, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: MMP-12 Antibody [NBP1-31225] - Imaging of Human breast cancer tissue. MMP12 is stained by antibody (green) and nucleus is stained with DAPI (blue). This image was submitted via customer Review.
(2 Reviews)
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
SLC10A4 GST (N-Term) ...
H00201780-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu

Publications for BCS1L Antibody (NBP1-88678) (0)

There are no publications for BCS1L Antibody (NBP1-88678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCS1L Antibody (NBP1-88678) (0)

There are no reviews for BCS1L Antibody (NBP1-88678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BCS1L Antibody (NBP1-88678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional BCS1L Products

Bioinformatics Tool for BCS1L Antibody (NBP1-88678)

Discover related pathways, diseases and genes to BCS1L Antibody (NBP1-88678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCS1L Antibody (NBP1-88678)

Discover more about diseases related to BCS1L Antibody (NBP1-88678).
 

Pathways for BCS1L Antibody (NBP1-88678)

View related products by pathway.

PTMs for BCS1L Antibody (NBP1-88678)

Learn more about PTMs related to BCS1L Antibody (NBP1-88678).

Blogs on BCS1L

There are no specific blogs for BCS1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCS1L Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BCS1L