Home » BCS1L » BCS1L Antibodies » BCS1L Antibody

BCS1L Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry: BCS1L Antibody [NBP1-88678] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiac myocytes.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining in human parathyroid gland and pancreas tissues using anti-BCS1L antibody. Corresponding BCS1L RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BCS1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAES
Specificity
Specificity of human BCS1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCS1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BCS1L Protein (NBP1-88678PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCS1L Antibody

  • BCS
  • BCS1 (yeast homolog)-like
  • BCS1
  • BCS1-like (S. cerevisiae)
  • BCS1-like (yeast)
  • BCS1-like protein
  • BJSGRACILE
  • FLNMS
  • h-BCS
  • h-BCS1
  • mitochondrial chaperone BCS1
  • mitochondrial complex III assembly
  • PTD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
IGF-I
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(2 Reviews)
(100 Publications)
Species: Hu

Nesfatin-1/Nucleobindi ...
AF6895
Western blot shows lysates of rat liver tissue and mouse pancreas tissue. PVDF membrane was probed with 2 µg/mL of Sheep Anti-Mouse/Rat Nesfatin‑1/Nucleobindin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6895) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Nesfatin‑1/Nucleobindin‑2 at approximately 50 to 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Nesfatin‑1/Nucleobindin‑2 was detected in immersion fixed frozen sections of rat brain (cortex) using Sheep Anti-Mouse/Rat Nesfatin‑1/Nucleobindin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6895) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to neuronal cell bodies and processes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of rat liver tissue, loaded at 0.2 mg/mL. A specific band was detected for Nesfatin‑1/Nucleobindin‑2 at approximately 55 kDa (as indicated) using 20 µg/mL of Sheep Anti-Mouse/Rat Nesfatin‑1/Nucleobindin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6895) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Mu, Rt
Applications: WB, Simple Western, IHC
DMPK Antibody
NBP1-85010
Western Blot: DMPK Antibody [NBP1-85010] - Analysis in human cell lines U-251MG and Caco-2 using Anti-DMPK antibody. Corresponding DMPK RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: DMPK Antibody [NBP1-85010] - Staining in human smooth muscle and liver tissues using anti-DMPK antibody. Corresponding DMPK RNA-seq data are presented for the same tissues.
Western Blot: DMPK Antibody [NBP1-85010] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: A-549
Species: Hu
Applications: WB, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(38 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
POMT1 Antibody
NBP2-57200
Immunocytochemistry/Immunofluorescence: POMT1 Antibody [NBP2-57200] - Staining of human cell line MCF7 shows localization to the Golgi apparatus.
Species: Hu
Applications: ICC/IF
Ceruloplasmin
Native Protein
NBP2-12553
HPLC: Ceruloplasmin Native Protein [NBP2-12553]
Species: Hu
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
Recombinant Human ErbB2/Her2 Fc Chimera (Catalog # 1129-ER) blocks anti-ErbB2 mediated inhibition of the SK‑BR‑3 human breast cancer cell line. The ED50 is 20-80 ng/mL in the presence of 0.6 μg/mL Goat Anti-Human ErbB2/Her2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1129)
(5 Reviews)
(26 Publications)
Species: Hu
Growth Hormone
Antibody [Unconjugate
AF1067
Growth Hormone was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, ICC
ER alpha/NR3A1
Antibody (EVG F9)
NB100-74413
Western Blot: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of various whole cell lysates.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of Estrogen Receptor alpha using Anti-Estrogen Receptor alpha Monoclonal Antibody (EVG F9) shows staining in U251 Cells. Estrogen Receptor alpha staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Estrogen Receptor alpha at a dilution of 1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Cancer biopsies of deparaffinized Human breast carcinoma tissues.
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-38770] - Staining of human placenta shows cytoplasmic positivity in decidual cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Recombinant Human
gamma-glutamyl hydrol ...
NBP1-78898
SDS-Page: Recombinant Human gamma-glutamyl hydrolase Protein [NBP1-78898]
Species: Hu
Recombinant Human
SLC10A4 Protein
H00201780-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu

Publications for BCS1L Antibody (NBP1-88678) (0)

There are no publications for BCS1L Antibody (NBP1-88678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCS1L Antibody (NBP1-88678) (0)

There are no reviews for BCS1L Antibody (NBP1-88678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BCS1L Antibody (NBP1-88678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCS1L Products

Bioinformatics Tool for BCS1L Antibody (NBP1-88678)

Discover related pathways, diseases and genes to BCS1L Antibody (NBP1-88678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCS1L Antibody (NBP1-88678)

Discover more about diseases related to BCS1L Antibody (NBP1-88678).
 

Pathways for BCS1L Antibody (NBP1-88678)

View related products by pathway.

PTMs for BCS1L Antibody (NBP1-88678)

Learn more about PTMs related to BCS1L Antibody (NBP1-88678).

Blogs on BCS1L

There are no specific blogs for BCS1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCS1L Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BCS1L