BCS1L Antibody

Images

 
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human skin shows moderate positivity in cytoplasm in squamous epithelial cells.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human parathyroid gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining in human parathyroid gland and pancreas tissues using anti-BCS1L antibody. Corresponding BCS1L RNA-seq data are ...read more
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human Fallopian tube shows moderate positivity in cytoplasm in glandular cells.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

BCS1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAES
Specificity
Specificity of human BCS1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCS1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BCS1L Protein (NBP1-88678PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCS1L Antibody

  • BCS
  • BCS1 (yeast homolog)-like
  • BCS1
  • BCS1-like (S. cerevisiae)
  • BCS1-like (yeast)
  • BCS1-like protein
  • BJSGRACILE
  • FLNMS
  • h-BCS
  • h-BCS1
  • mitochondrial chaperone BCS1
  • mitochondrial complex III assembly
  • PTD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB6967
Species: Hu
Applications: WB
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-31225
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BCS1L Antibody (NBP1-88678) (0)

There are no publications for BCS1L Antibody (NBP1-88678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCS1L Antibody (NBP1-88678) (0)

There are no reviews for BCS1L Antibody (NBP1-88678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BCS1L Antibody (NBP1-88678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BCS1L Products

Bioinformatics Tool for BCS1L Antibody (NBP1-88678)

Discover related pathways, diseases and genes to BCS1L Antibody (NBP1-88678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCS1L Antibody (NBP1-88678)

Discover more about diseases related to BCS1L Antibody (NBP1-88678).
 

Pathways for BCS1L Antibody (NBP1-88678)

View related products by pathway.

PTMs for BCS1L Antibody (NBP1-88678)

Learn more about PTMs related to BCS1L Antibody (NBP1-88678).

Blogs on BCS1L

There are no specific blogs for BCS1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCS1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCS1L