BCS1L Antibody

Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human skin shows moderate positivity in cytoplasm in squamous epithelial cells.

Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining in human parathyroid gland and pancreas tissues using anti-BCS1L antibody. Corresponding BCS1L RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human Fallopian tube shows moderate positivity in cytoplasm in glandular cells.

Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: BCS1L Antibody [NBP1-88678] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BCS1L Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAES
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCS1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BCS1L Protein (NBP1-88678PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BCS1L Antibody

• BCS
• BCS1 (yeast homolog)-like
• BCS1
• BCS1-like (S. cerevisiae)
• BCS1-like (yeast)
• BCS1-like protein
• BJSGRACILE
• FLNMS
• h-BCS
• h-BCS1
• mitochondrial chaperone BCS1
• mitochondrial complex III assembly
• PTD

Background

BCS1L encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCS1L