Recombinant Human SLC10A4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC10A4 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 437 of Human SLC10A4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSPGPTPTPEPTTSGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGLGCTVDVNHFGAHVRRPVGALLAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGGNLSNLMSLLVDGDMNLSIIMTISSTLLALVLMPLCLWIYSWAWINTPIVQLLPLGTVTLTLCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVLFIMTGTMLGPELLASIPAAVYVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SLC10A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
72.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC10A4 GST (N-Term) Protein

  • bile acid transporter SLC10A4
  • MGC29802
  • Na(+)/bile acid cotransporter 4
  • P4
  • sodium/bile acid cotransporter 4
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 4
  • Solute carrier family 10 member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-59707
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38770
Species: Hu, Mu
Applications: WB
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-59875
Species: Hu
Applications: WB

Publications for SLC10A4 Recombinant Protein (H00201780-P01) (0)

There are no publications for SLC10A4 Recombinant Protein (H00201780-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC10A4 Recombinant Protein (H00201780-P01) (0)

There are no reviews for SLC10A4 Recombinant Protein (H00201780-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC10A4 Recombinant Protein (H00201780-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SLC10A4 Products

Array H00201780-P01

Bioinformatics Tool for SLC10A4 Recombinant Protein (H00201780-P01)

Discover related pathways, diseases and genes to SLC10A4 Recombinant Protein (H00201780-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A4 Recombinant Protein (H00201780-P01)

Discover more about diseases related to SLC10A4 Recombinant Protein (H00201780-P01).
 

Pathways for SLC10A4 Recombinant Protein (H00201780-P01)

View related products by pathway.

Blogs on SLC10A4

There are no specific blogs for SLC10A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC10A4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC10A4