BCL2L15 Antibody

Images

 
Immunohistochemistry-Paraffin: BCL2L15 Antibody [NBP1-90767] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BCL2L15 Antibody [NBP1-90767] - staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BCL2L15 Antibody [NBP1-90767] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: BCL2L15 Antibody [NBP1-90767] - Staining of human skin shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: BCL2L15 Antibody [NBP1-90767] - Staining in human duodenum and skin tissues using anti-BCL2L15 antibody. Corresponding BCL2L15 RNA-seq data are presented for ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: BCL2L15 Antibody [NBP1-90767] - Analysis in human duodenum and testis tissues. Corresponding BCL2L15 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

BCL2L15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QTGAILQNTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWE
Specificity
Specificity of human BCL2L15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCL2L15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BCL2L15 Protein (NBP1-90767PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCL2L15 Antibody

  • BCL2-like 15
  • FLJ22588
  • pro-apoptotic Bcl-2 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF816
Species: Hu
Applications: WB, ICC
AF820
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, IHC, IHC-P, IF
NBP2-67514
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP2-67400
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Fi, Gp, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KD, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47810
Species: Hu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-61706
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-614
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90767
Species: Hu
Applications: IHC, IHC-P

Publications for BCL2L15 Antibody (NBP1-90767) (0)

There are no publications for BCL2L15 Antibody (NBP1-90767).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL2L15 Antibody (NBP1-90767) (0)

There are no reviews for BCL2L15 Antibody (NBP1-90767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BCL2L15 Antibody (NBP1-90767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BCL2L15 Products

Bioinformatics Tool for BCL2L15 Antibody (NBP1-90767)

Discover related pathways, diseases and genes to BCL2L15 Antibody (NBP1-90767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BCL2L15

There are no specific blogs for BCL2L15, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCL2L15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L15