MEKK1 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit MEKK1 Antibody - Azide and BSA Free (NBP3-02962) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1400-1512 of human MEKK1 (NP_005912.1). TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MAP3K1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:100
- Immunohistochemistry 1:50-1:100
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:2000
|
| Theoretical MW |
164 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS with 50% glycerol, pH7.3. |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for MEKK1 Antibody - Azide and BSA Free
Background
MEKKs (Mitogen activated protein kinase kinase kinases) are serine-threonine kinases that act as the first tier of cellular MAP kinase pathways by activation of MAP/ERK kinases, or MEKs. Many enzymes with MEKK activity have been identified, including MEKK1-4, Raf, MLK3, TAK, and DLK. MEKKs generally display little similarity outside of their catalytic kinase domains. MEKK1-4 are nearly 50% identical within their catalytic domains, and are known to regulate Erk, Jnk, and p38 MAP kinase pathways. MEKK2 and MEKK3 bind MEK5 via conserved PB1 domains, leading to downstream activation of Erk5.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for MEKK1 Antibody (NBP3-02962) (0)
There are no publications for MEKK1 Antibody (NBP3-02962).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MEKK1 Antibody (NBP3-02962) (0)
There are no reviews for MEKK1 Antibody (NBP3-02962).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MEKK1 Antibody (NBP3-02962) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MEKK1 Products
Research Areas for MEKK1 Antibody (NBP3-02962)
Find related products by research area.
|
Blogs on MEKK1