Novus Biologicals products are now on bio-techne.com

MEKK1 Antibody - Azide and BSA Free

Images

 
Western Blot: MEKK1 Antibody [NBP3-02962] - Analysis of extracts of various cell lines, using MEKK1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: ...read more
Immunocytochemistry/ Immunofluorescence: MEKK1 Antibody [NBP3-02962] - Analysis of L929 cells using MEKK1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MEKK1 Antibody [NBP3-02962] - Mouse kidney using MEKK1 antibody (NBP3-02962) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before ...read more
Immunohistochemistry-Paraffin: MEKK1 Antibody [NBP3-02962] - Human liver using MAP3K1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC ...read more
Immunohistochemistry-Paraffin: MEKK1 Antibody [NBP3-02962] - Rat liver using MAP3K1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

MEKK1 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1400-1512 of human MEKK1 (NP_005912.1). TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP3K1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
Theoretical MW
164 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for MEKK1 Antibody - Azide and BSA Free

  • Map3k1
  • MAPK/ERK kinase kinase 1
  • MAPKKK1MAP/ERK kinase kinase 1
  • MEK kinase 1
  • MEKK1EC 2.7.11.25
  • MEKKMEKK 1
  • mitogen-activated protein kinase kinase kinase 1

Background

MEKKs (Mitogen activated protein kinase kinase kinases) are serine-threonine kinases that act as the first tier of cellular MAP kinase pathways by activation of MAP/ERK kinases, or MEKs. Many enzymes with MEKK activity have been identified, including MEKK1-4, Raf, MLK3, TAK, and DLK. MEKKs generally display little similarity outside of their catalytic kinase domains. MEKK1-4 are nearly 50% identical within their catalytic domains, and are known to regulate Erk, Jnk, and p38 MAP kinase pathways. MEKK2 and MEKK3 bind MEK5 via conserved PB1 domains, leading to downstream activation of Erk5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-02962
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for MEKK1 Antibody (NBP3-02962) (0)

There are no publications for MEKK1 Antibody (NBP3-02962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK1 Antibody (NBP3-02962) (0)

There are no reviews for MEKK1 Antibody (NBP3-02962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEKK1 Antibody (NBP3-02962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEKK1 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K1