Plectin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Plectin Antibody [NBP1-84020] - Plectin antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody. Nuclei stained with ...read more
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunocytochemistry/ Immunofluorescence: Plectin Antibody [NBP1-84020] - Staining of human cell line U-2 OS shows localization to cytosol & intermediate filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human skeletal muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining in human skeletal muscle and pancreas tissues using anti-PLEC antibody. Corresponding PLEC RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human testis.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Analysis in human skeletal muscle and liver tissues. Corresponding Plectin RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-Plectin antibody NBP1-84020 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plectin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILIT
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Plectin Protein (NBP1-84020PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-84020 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plectin Antibody

  • EBS1
  • HD1
  • Hemidesmosomal protein 1
  • LGMD2Q
  • PCNplectin 1, intermediate filament binding protein, 500kD
  • PLEC1b
  • PLEC1EBSO
  • plectin 1, intermediate filament binding protein 500kDa
  • plectin
  • plectin-1
  • PLTNepidermolysis bullosa simplex 1 (Ogna)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
MAB9080
Species: Hu
Applications: WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-91800
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1107
Species: Mu
Applications: IHC, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-67451
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13795
Species: Hu
Applications: IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

Publications for Plectin Antibody (NBP1-84020) (0)

There are no publications for Plectin Antibody (NBP1-84020).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Plectin Antibody (NBP1-84020) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-84020:
Filter by Applications
Indirect Immunofluorescence
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Other Plectin NBP1-84020
Enlarge
5
reviewed by:
Verified Customer
Indirect Immunofluorescence Human 05/03/2022
View

Summary

ApplicationOther
Sample TestedCell culture
SpeciesHuman
Lot000001611

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Plectin Antibody (NBP1-84020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plectin Products

Bioinformatics Tool for Plectin Antibody (NBP1-84020)

Discover related pathways, diseases and genes to Plectin Antibody (NBP1-84020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plectin Antibody (NBP1-84020)

Discover more about diseases related to Plectin Antibody (NBP1-84020).
 

Pathways for Plectin Antibody (NBP1-84020)

View related products by pathway.

PTMs for Plectin Antibody (NBP1-84020)

Learn more about PTMs related to Plectin Antibody (NBP1-84020).

Blogs on Plectin

There are no specific blogs for Plectin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
05/03/2022
Application: Indirect Immunofluorescence
Species: Human

Bioinformatics

Gene Symbol PLEC