Plectin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Plectin Antibody [NBP1-84020] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & intermediate filaments.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plectin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILIT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Plectin Protein (NBP1-84020PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plectin Antibody

  • EBS1
  • HD1
  • Hemidesmosomal protein 1
  • LGMD2Q
  • PCNplectin 1, intermediate filament binding protein, 500kD
  • PLEC1b
  • PLEC1EBSO
  • plectin 1, intermediate filament binding protein 500kDa
  • plectin
  • plectin-1
  • PLTNepidermolysis bullosa simplex 1 (Ogna)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Plectin Antibody (NBP1-84020) (0)

There are no publications for Plectin Antibody (NBP1-84020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plectin Antibody (NBP1-84020) (0)

There are no reviews for Plectin Antibody (NBP1-84020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Plectin Antibody (NBP1-84020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plectin Products

Bioinformatics Tool for Plectin Antibody (NBP1-84020)

Discover related pathways, diseases and genes to Plectin Antibody (NBP1-84020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plectin Antibody (NBP1-84020)

Discover more about diseases related to Plectin Antibody (NBP1-84020).
 

Pathways for Plectin Antibody (NBP1-84020)

View related products by pathway.

PTMs for Plectin Antibody (NBP1-84020)

Learn more about PTMs related to Plectin Antibody (NBP1-84020).

Blogs on Plectin

There are no specific blogs for Plectin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plectin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEC