BCKDHA Antibody - BSA Free

Western Blot: BCKDHA Antibody [NBP1-79616] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: BCKDHA Antibody [NBP1-79616] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in alveolar type I & II cells

Western Blot: BCKDHA Antibody [NBP1-79616] - Human Adult Placenta.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BCKDHA Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human BCKDHAThe immunogen for this antibody is BCKDHA. Peptide sequence NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCKDHA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26571352)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BCKDHA Antibody - BSA Free

• 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
• BCKDE1A
• BCKDH E1-alpha
• branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urinedisease)
• branched chain keto acid dehydrogenase E1, alpha polypeptide
• Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain
• EC 1.2.4.4,2-oxoisovalerate dehydrogenase (lipoamide)
• FLJ45695
• MSU
• MSUD1
• OVD1A

Background

BCKDHA - branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urine disease)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BCKDHA Antibody (NBP1-79616)(4)

Publications using NBP1-79616

• Green CR, Alaeddine LM, Wessendorf-Rodriguez KA et Al. Impaired branched-chain amino acid (BCAA) catabolism during adipocyte differentiation decreases glycolytic flux J Biol Chem 2024-11-15 [PMID: 39551140]
• Zhou M, Jing S, Wu CY et al. Targeting BCAA Catabolism to Treat Obesity-Associated Insulin Resistance Diabetes 2019-06-05 [PMID: 31167878]
• Wallace M, Green CR, Roberts LS et al. Enzyme promiscuity drives branched-chain fatty acid synthesis in adipose tissues. Nat. Chem. Biol. 2018-11-01 [PMID: 30327559] (WB, Mouse)
• Green CR, Wallace M, Divakaruni AS et al. Branched-chain amino acid catabolism fuels adipocyte differentiation and lipogenesis. Nat. Chem. Biol. 2016-01-01 [PMID: 26571352] (WB, Mouse)

Bioinformatics

• Gene Symbol: BCKDHA
• Uniprot:
  • NP_000700(Human)