We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Bad Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: Bad Antibody [NBP1-88698] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: Bad Antibody [NBP1-88698] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Bad Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAD
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Bad Protein (NBP1-88698PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Bad Antibody - BSA Free

  • Bad
  • BBC2
  • BBC6
  • bcl2 antagonist of cell death
  • BCL2-antagonist of cell death protein
  • BCL2-associated agonist of cell death
  • Bcl-2-binding component 6
  • BCL2-binding component 6
  • BCL2-binding protein
  • BCL2L8
  • Bcl2-L-8
  • BCL2L8bcl2-L-8
  • Bcl-2-like protein 8
  • BCL-X/BCL-2 binding protein
  • Bcl-XL/Bcl-2-associated death promoter

Background

Bad is a pro-apoptotic member of the Bcl-2 family. Bad will bind preferentially Bcl-xL over Bcl-2 through its partial (9-16 a.a) BH3 domain. Additionally, Bad can reverse the death repressor activity of Bcl-xL but not of Bcl-2. Upon dephosphorylation, activated Bad translocates to the mitochondria and displace Bcl-2 from tBid sequestration to initiate mitochondrial dysfunction. The switching on/off of its phosphorylation by growth/survival factors regulates Bad activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-88698
Species: Hu
Applications: ICC/IF, IHC

Publications for Bad Antibody (NBP1-88698) (0)

There are no publications for Bad Antibody (NBP1-88698).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bad Antibody (NBP1-88698) (0)

There are no reviews for Bad Antibody (NBP1-88698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Bad Antibody (NBP1-88698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bad Products

Research Areas for Bad Antibody (NBP1-88698)

Find related products by research area.

Blogs on Bad.

Pathway Highlight: Which caspase substrates contribute to the morphological features associated with apoptosis?
Apoptosis, or programmed cell death, is controlled by a caspase signal cascade that activates downstream signals to induce the morphological changes used to differentiate apoptosis from other forms of cell death.  Novus Biologicals offers a variet...  Read full blog post.

Altered expression of BCL2 in cancer
Similar to other cell processes, the balance between cell survival and cell death is an important equilibrium that when altered expression of genes can lead to a variety of disease.  For example, too little cell death can promote cell overgrowth a...  Read full blog post.

Cytochrome C - a mediator of apoptosis
Cytochrome C is a small heme protein within the inner mitochondrial membrane responsible for carrying electrons within the respiratory transport chain.  Additionally, cytochrome c has also been identified as a player in programmed cell death (apop...  Read full blog post.

AKT Antibody Assays: A Complex Area with an Easy Solution
We at Novus Biologicals place a lot of emphasis on the kinase signaling pathways. Kinases, or phosphotransferase enzymes play a key role in phosphorylation signaling. Over 500 human protein kinases have so far been discovered. They play essential role...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bad Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol BAD